SecReT6
Protein ID: 78221498
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0275
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]306508..308880 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-20, Aligned region: 315..375
ImpA-rel_N [PF06812], Evalue: 3.60E-20, Aligned region: 612..625
DUF2094 [PF09867], Evalue: 5.00E-11, Aligned region: 14..128
DUF2094 [PF09867], Evalue: 5.00E-11, Aligned region: 698..733
Protein Sequence: 790 a.a.     [Download]
>gi|78221498|ref|YP_383245.1| unnamed protein product [Geobacter metallireducens GS-15]
MLGTDMTTGWNWSAFGKHPAAADYFRLGHASPFVEGLTKWVESGYRLLAERSDAPPAFCSWRFWARGYGR
DPLVLGVVRVSSDSLGRPYPLLIMGSGPLEGWEGQWDLLPFAAEKSWCQIEFLATHTFGDLRKLEEGLQG
LRPPAAEWDELAERRGGLNRLGSPLDPYASFLDIPRLEKVAAERAGRDEFSVRLDRGPVNDKITLVSLWH
LLAKGAAKGVPNALFMGGTLERSFLASYRRALAPGDFLHLWSASDAAGWPNSIGTEYAMDIATLGKEPVR
PDQPVGDDVRYDPLFDTLQAEVDKLTSPAIAGNIDWEKVVRLSADILATRSKDLLVASYLAVGLVQTRGG
DGLALGLKVWRDLLERFWNDLYPTRMRGRQRSVEWWLDRTEIALRQQGEQTLPGEQHVIVLETLGAIDRF
LRERLENAPSLTKLRELVVDMAPEVNVEAVAEAAAPPPVQAEAPADLFTPPSQVAVRPVEVPRQTSIPGS
PLQALEAGLRQVGEAAGALLQQDPSSPVPYRLSRLAAWGQVTELPPAVNGRTRIPPPERQVLTLLQELAS
HGDGEALLKAAEARLPQFIFWLDLNRFTAEALSRLGDRFSSAREAVCAETAALAGRLPGLEGLSFADGTP
FADGETRQWLAGVMQRESSAAQCPAEADTEGRAEAIAQEVDEAQALIRSGKLLEAVERFQGHLGNGASRK
EKLHWRLALAQLLVNTNRAKLALPHLEQVVADIGAFGLEEYDPALALRGLKLAWIGFDSQAEPRFKEKAA
EALHRIARLDPVEMVRLAKG
 
Nucleotide Sequence: 2373 bp     [Download]
>gi|78221228|ref|NC_007517.1|:306508-308880 Geobacter metallireducens GS-15 chromosome, complete genome
ATGCTCGGCACTGACATGACAACCGGCTGGAACTGGTCAGCCTTCGGCAAGCACCCGGCGGCGGCCGATT
ACTTCCGCCTCGGCCATGCTTCCCCCTTCGTGGAGGGCCTCACGAAATGGGTGGAGAGCGGCTACCGGCT
CCTGGCGGAGCGAAGCGACGCCCCGCCCGCGTTCTGCTCCTGGCGCTTCTGGGCCCGGGGCTATGGCCGG
GACCCACTGGTCCTGGGAGTGGTGCGGGTCTCCAGCGACAGCCTCGGCCGCCCCTATCCCCTCCTTATCA
TGGGGAGCGGTCCCCTGGAGGGGTGGGAGGGGCAATGGGACCTCCTCCCCTTTGCCGCGGAGAAGAGTTG
GTGCCAGATCGAATTCCTGGCCACCCATACCTTCGGCGACCTCAGGAAGTTGGAAGAGGGGCTCCAGGGG
CTGCGTCCCCCTGCCGCCGAGTGGGACGAGCTGGCCGAACGCCGCGGGGGGCTGAATCGCCTCGGCTCCC
CCCTGGACCCCTACGCCTCGTTCCTGGACATTCCCCGGCTGGAAAAGGTAGCCGCCGAACGGGCCGGGCG
GGACGAGTTCTCGGTGCGGCTCGACCGTGGGCCGGTCAACGACAAGATCACCCTGGTGAGCCTCTGGCAC
CTGCTGGCCAAGGGGGCGGCGAAGGGAGTCCCCAATGCCCTCTTCATGGGGGGAACCCTGGAGCGCTCCT
TTCTCGCCTCCTACCGGCGGGCCCTGGCTCCGGGGGATTTTCTCCACCTCTGGTCCGCCTCGGATGCCGC
GGGGTGGCCCAACAGCATCGGAACGGAGTACGCCATGGATATAGCAACCCTGGGAAAAGAGCCTGTTCGC
CCCGACCAGCCGGTGGGTGACGACGTCCGCTACGATCCCCTCTTCGACACTCTCCAGGCCGAGGTGGACA
AACTAACCTCCCCGGCCATCGCCGGCAACATCGACTGGGAGAAGGTGGTGCGGCTATCAGCCGACATCCT
GGCCACCCGCTCCAAGGACCTCCTGGTGGCCAGCTACCTGGCCGTGGGGCTCGTCCAGACCCGCGGCGGC
GACGGCCTGGCCCTGGGGCTCAAGGTCTGGCGCGATCTCCTGGAGCGGTTCTGGAACGACCTCTACCCCA
CCCGGATGCGGGGACGTCAGCGGAGCGTGGAGTGGTGGCTGGACCGGACCGAGATCGCCCTGCGCCAGCA
GGGGGAGCAGACCCTGCCGGGGGAACAGCACGTCATCGTGCTGGAGACCCTCGGCGCCATCGACCGCTTC
CTGCGCGAGCGCCTGGAGAATGCCCCGTCCCTCACCAAATTGCGGGAGCTGGTAGTGGATATGGCGCCGG
AAGTGAACGTGGAGGCGGTTGCCGAAGCCGCGGCCCCACCGCCGGTTCAGGCCGAGGCGCCGGCCGATCT
CTTTACCCCCCCGAGCCAGGTCGCTGTCCGCCCCGTGGAGGTCCCCCGGCAGACAAGCATCCCAGGCTCA
CCCCTTCAGGCCCTCGAAGCGGGGTTGCGGCAAGTGGGGGAGGCTGCCGGAGCCCTGCTCCAGCAGGACC
CCTCAAGTCCGGTACCTTACCGTCTTTCACGGCTCGCCGCCTGGGGTCAAGTTACGGAGCTTCCGCCGGC
TGTGAACGGCCGCACCCGCATCCCCCCTCCCGAGCGCCAGGTGTTGACTCTCCTCCAGGAGCTGGCCAGC
CACGGCGACGGCGAAGCGCTCCTCAAGGCCGCCGAAGCGCGGCTTCCCCAGTTCATCTTCTGGCTTGACC
TGAACCGATTTACCGCCGAAGCCCTTTCCCGCCTTGGCGACCGTTTCTCCTCTGCCCGCGAGGCGGTCTG
CGCCGAGACGGCGGCCCTTGCGGGGCGGCTTCCGGGCCTTGAGGGGCTCTCCTTTGCCGACGGCACTCCC
TTCGCCGATGGGGAGACCCGCCAGTGGCTCGCGGGGGTCATGCAGCGGGAGTCATCCGCCGCCCAATGCC
CCGCCGAAGCCGATACCGAAGGCCGGGCCGAGGCCATCGCCCAAGAGGTTGATGAGGCCCAGGCCCTCAT
CCGGAGCGGCAAGCTCCTGGAGGCGGTGGAGCGGTTCCAGGGGCACCTGGGCAACGGTGCCTCCCGCAAG
GAAAAACTCCACTGGCGCCTCGCCCTGGCCCAGCTCCTCGTGAACACCAACCGGGCGAAGTTGGCGCTCC
CCCACCTGGAGCAGGTCGTGGCCGACATTGGGGCCTTCGGCCTCGAAGAGTACGACCCGGCCCTGGCCCT
GCGGGGGCTGAAGCTCGCCTGGATCGGCTTCGATTCCCAGGCCGAACCCCGCTTCAAGGAGAAGGCCGCC
GAGGCCCTCCACCGCATCGCCCGCCTCGACCCGGTGGAGATGGTGCGGCTGGCCAAGGGGTAA