SecReT6
Protein ID: 78221501
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0278
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]309957..310445 [+]
Producthypothetical protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-56, Aligned region: 5..158
Protein Sequence: 162 a.a.     [Download]
>gi|78221501|ref|YP_383248.1| unnamed protein product [Geobacter metallireducens GS-15]
MSKEASVAPKERVNIVYRPASDGAAEEVELPLKMLVMGDFTGTPDERPVEKRDPVAIDKETFNDVMKAQG
ISLNIAVPNRLAGEAGDELPVNLKVESLKDFGPEAVVEQVPEMKRLLELREALRALKGPLSNVPDFRRKI
QELITDDAARAKLLAEIGIEEG
 
Nucleotide Sequence: 489 bp     [Download]
>gi|78221228|ref|NC_007517.1|:309957-310445 Geobacter metallireducens GS-15 chromosome, complete genome
ATGTCGAAAGAAGCATCCGTAGCACCGAAGGAACGGGTCAATATCGTCTACCGTCCGGCCTCGGACGGCG
CTGCCGAAGAGGTTGAGCTGCCGCTGAAAATGCTCGTTATGGGGGACTTTACCGGCACCCCCGACGAACG
CCCCGTCGAGAAGCGGGACCCCGTCGCCATCGACAAGGAGACCTTCAACGACGTCATGAAGGCCCAGGGG
ATCTCCCTGAACATCGCCGTCCCCAACCGGCTCGCCGGCGAGGCCGGGGACGAGCTGCCGGTGAACCTGA
AGGTTGAGTCACTCAAGGACTTCGGCCCCGAGGCGGTGGTGGAGCAGGTCCCCGAGATGAAGCGGCTCCT
GGAGCTGCGGGAGGCCCTGCGGGCCCTCAAGGGGCCGCTTTCCAACGTTCCCGACTTCCGGAGGAAGATC
CAGGAACTGATCACCGACGACGCGGCCCGGGCCAAGCTTCTGGCTGAAATCGGCATCGAGGAAGGGTAA