SecReT6
Protein ID: 78221502
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0279
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]310458..311936 [+]
Producthypothetical protein
NoteTssC
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-190, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|78221502|ref|YP_383249.1| unnamed protein product [Geobacter metallireducens GS-15]
MSVEQQNTAAVESRIEGSLLEEIVQATKLQPADEAYSITKKGVEALITQLLEPGTETPKVSKAVLDDMIA
EIDKKLSRQMDEILHNTQFQKLESSWRSLHFLVDRTDFRENNRIEIMNATKDELLDDFEDAPEVAKSGLY
KTVYSAEYGQFGGKPYGAIIGNYDFGPGPQDIKLLQSLAAVSGMAHAPFIAAASPQFFGCDDYTALPNLK
DIKSILEGPQYAKWQSFRESEDARYVGLALPRFLLRLPYGEATKPVKSFNYEESVSAGHDRYCWGNAAFS
FATRLTESFANFRWCANIIGPQGGGAVHDLPLHQYEAMGAIQTKIPTEVLVSERREFELAEEGFIALTMR
KGSDNAAFFSANSVQKPKYFGTSKEGKEAELNYKLGLQLPYMFIVSRLAHYLKVIQREHIGTWKERGDLE
NELNLWIRQYVSEMDNPMPGVRSRRPLRQAQVTVEEVPGEPGWYRVGLKVTPHFKYMGAYFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|78221228|ref|NC_007517.1|:310458-311936 Geobacter metallireducens GS-15 chromosome, complete genome
ATGAGCGTAGAACAGCAAAACACCGCAGCAGTCGAGAGCCGGATAGAAGGATCGCTTCTGGAGGAGATTG
TCCAGGCCACGAAGCTCCAGCCCGCCGACGAGGCCTACTCCATCACCAAGAAGGGGGTCGAGGCCCTTAT
CACCCAACTTCTGGAGCCGGGGACCGAGACCCCGAAGGTCTCCAAGGCGGTCCTCGACGACATGATCGCC
GAGATCGACAAGAAGCTTTCCCGGCAGATGGACGAGATCCTCCACAATACCCAGTTCCAGAAGCTGGAAT
CCTCCTGGCGTTCCCTCCACTTCCTGGTGGACCGGACCGACTTCCGGGAGAACAACCGGATCGAGATCAT
GAACGCCACCAAGGATGAGCTCCTGGACGACTTCGAGGATGCTCCCGAGGTGGCCAAGTCGGGGCTCTAC
AAGACCGTCTATTCCGCCGAGTACGGCCAGTTCGGCGGCAAACCCTACGGCGCCATTATCGGCAACTACG
ACTTCGGCCCCGGCCCCCAGGACATCAAGCTTCTCCAGAGCCTGGCCGCCGTGTCCGGCATGGCCCACGC
CCCCTTCATCGCCGCCGCTTCCCCCCAGTTCTTCGGCTGCGACGACTACACGGCGCTGCCGAACCTCAAA
GACATCAAGTCGATCCTCGAAGGCCCCCAGTACGCCAAGTGGCAGTCGTTCCGGGAGAGCGAGGACGCCC
GCTACGTGGGGCTGGCCCTGCCCCGGTTCCTCCTGCGGCTCCCCTACGGCGAGGCCACCAAGCCGGTGAA
GAGCTTCAACTACGAGGAGAGCGTCTCCGCCGGCCACGACCGCTACTGCTGGGGGAACGCCGCCTTCTCC
TTTGCCACGCGGCTTACCGAGAGCTTCGCCAACTTCCGCTGGTGCGCCAACATCATCGGCCCCCAGGGAG
GCGGCGCGGTGCATGATCTACCCCTCCACCAGTACGAGGCCATGGGGGCCATCCAGACCAAGATTCCCAC
GGAAGTGCTCGTCAGCGAGCGGCGCGAATTCGAACTGGCCGAGGAAGGGTTCATCGCCCTCACCATGAGA
AAGGGGAGCGACAACGCCGCCTTCTTCTCCGCCAACTCCGTGCAGAAGCCGAAATACTTCGGCACCAGCA
AGGAGGGGAAAGAGGCCGAGCTCAACTACAAGCTGGGGCTCCAGCTCCCCTACATGTTCATCGTGAGCCG
CCTCGCCCACTACCTGAAAGTCATCCAGCGGGAGCACATCGGCACCTGGAAGGAGCGGGGCGACCTGGAA
AACGAGCTGAACCTCTGGATCCGCCAGTATGTCTCCGAGATGGACAACCCCATGCCCGGCGTGCGGAGCA
GAAGGCCCCTGCGCCAGGCCCAGGTCACCGTAGAGGAAGTCCCCGGCGAGCCCGGCTGGTACCGGGTCGG
CCTTAAGGTTACCCCCCACTTCAAGTACATGGGGGCTTATTTTACCCTCTCTTTGGTTGGAAAGCTGGAT
AAAGAATAA