SecReT6
Protein ID: 78221503
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0280
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]312033..312518 [+]
Producthypothetical protein
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-42, Aligned region: 7..146
Protein Sequence: 161 a.a.     [Download]
>gi|78221503|ref|YP_383250.1| unnamed protein product [Geobacter metallireducens GS-15]
MAMPAHLTLTGEKQGKIDGSCELQGREKTILVYSMNHDIHMPKDPHSGLPTGKRVHGPLSIVKEFDASSP
KMYQALCTGEHLKDVTLKFYRITKQGTEEHYYTIKLEDAIVVSMKPYMPVTLLEENNPYRHMEEVAFTYR
KIKWTWEPNGIEAEDSWSVPK
 
Nucleotide Sequence: 486 bp     [Download]
>gi|78221228|ref|NC_007517.1|:312033-312518 Geobacter metallireducens GS-15 chromosome, complete genome
ATGGCAATGCCCGCACACCTCACCCTCACCGGTGAAAAACAGGGGAAGATTGACGGTTCCTGTGAACTGC
AGGGACGTGAAAAAACCATCCTCGTCTACTCCATGAATCACGACATCCACATGCCGAAGGATCCCCACTC
GGGGCTTCCCACCGGCAAGCGGGTTCACGGCCCCCTGAGCATCGTAAAGGAGTTCGACGCCAGCTCCCCC
AAGATGTACCAGGCCCTCTGCACTGGTGAGCACCTAAAGGACGTCACCCTCAAGTTCTACCGCATCACCA
AGCAGGGGACCGAGGAGCACTACTACACCATCAAGCTCGAAGACGCCATCGTGGTCAGCATGAAGCCCTA
CATGCCGGTAACACTCCTGGAGGAGAACAATCCCTACCGCCACATGGAAGAAGTGGCCTTCACCTACCGC
AAGATCAAGTGGACCTGGGAGCCCAACGGCATCGAAGCCGAGGATTCCTGGAGCGTGCCCAAGTAG