SecReT6
Protein ID: 78221509
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0286
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]317492..319621 [+]
ProductRhs element Vgr protein:Gp5-like
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.00E-64, Aligned region: 35..339
Phage_base_V [PF04717], Evalue: 2.80E-22, Aligned region: 378..468
Gp5_C [PF06715], Evalue: 2.80E-11, Aligned region: 520..532
Gp5_C [PF06715], Evalue: 2.80E-11, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 2.80E-11, Aligned region: 554..577
Gp5_C [PF06715], Evalue: 2.80E-11, Aligned region: 598..617
Gp5_C [PF06715], Evalue: 2.80E-11, Aligned region: 628..649
DUF2345 [PF10106], Evalue: 0.0086, Aligned region: 206..222
DUF2345 [PF10106], Evalue: 0.0086, Aligned region: 506..584
DUF2345 [PF10106], Evalue: 0.0086, Aligned region: 643..704
Protein Sequence: 709 a.a.     [Download]
>gi|78221509|ref|YP_383256.1| unnamed protein product [Geobacter metallireducens GS-15]
MDILNLFNNSSSATFLFEVSGSAADMSVVSFTANEWMSLPYSVSVAFATPYGIESFDDIIGSEALLTIIN
KDLLAGGEDRYFHGIVRRLERIGSSSNNYCLYEAEIVPAVFQLSLRKNSRIFQNTMTQDIVKQLLEESGI
TSDRYRFALQNKERLRKFCVQYRETDLDFVTRLLEEEGMFYFFEHYSDKHVLVISDSSVVHVPINGNPSI
TFNSNGGMVAETESIYGFTSSQRMTSEVFVHRNFNFKNPSVDMTAKASDSQESKREIYEYPALHVTQERG
SALARAHREGLKTMQKQGHGQSSSCRLTPGYNFALIGHDSASLNIEYLIVDVSHSGTQPQSLEEMSQGPF
SYGNSFTVIPATTPFRPTATRQKPIVKGIQTAIVVGPKGEEIYADEYGRIKVQFHWDREGRRDEKSSCWL
RIGQTWSGNGWGMINIPRIGDEVLVDFIDGDPDRPIIVGSVNNAESPALFSLPANKTQSGIRTRSYPNGG
RDNYHELRFEDKKGSEEIYLQSEKDWNILVKNDKTQNVEHDEALHVANNRLKTVGVDQMVQVGANHTEII
GANKSISVGSNKTETVGLNSAETVGLAKELTIGGLYQVSVGGVMNETVIGAKAEEVGVTKAVLVGAHMTE
KVAGNRSLTVGQNLSATVSQNTTVKAKAIVLEADDEIIFKTGSSTISLKSSGEIVVTGATITEKASGEIV
IKGARTSVN
 
Nucleotide Sequence: 2130 bp     [Download]
>gi|78221228|ref|NC_007517.1|:317492-319621 Geobacter metallireducens GS-15 chromosome, complete genome
GTGGACATACTCAACTTATTCAACAATTCTTCAAGTGCGACATTTCTGTTCGAGGTTTCCGGTTCTGCAG
CCGATATGTCAGTCGTGAGTTTTACCGCTAACGAGTGGATGTCCTTGCCATACTCGGTAAGCGTTGCCTT
TGCCACTCCATACGGAATTGAATCCTTCGACGACATAATCGGTAGCGAAGCCCTGCTGACAATTATCAAC
AAAGACTTGCTTGCCGGAGGAGAGGATCGCTACTTTCACGGGATTGTCAGACGACTTGAGCGTATTGGCT
CAAGTAGCAACAATTATTGCCTCTATGAAGCCGAGATCGTTCCGGCTGTTTTTCAGCTCTCCCTGCGCAA
AAACTCCAGAATTTTCCAGAACACTATGACCCAGGACATCGTCAAACAGCTTCTGGAGGAAAGTGGTATC
ACCTCGGACAGATACCGCTTTGCCCTCCAAAACAAGGAGCGGTTGCGGAAATTTTGCGTTCAATACAGGG
AGACGGATCTCGATTTTGTAACTCGACTTCTCGAAGAAGAAGGGATGTTTTACTTTTTCGAGCATTATTC
CGATAAGCATGTTCTTGTTATAAGTGACAGCAGTGTTGTCCACGTTCCAATCAACGGTAATCCTTCGATT
ACCTTCAACTCAAACGGCGGCATGGTTGCTGAGACAGAAAGCATCTATGGCTTTACCTCGTCCCAAAGGA
TGACATCAGAGGTATTCGTTCATCGGAACTTTAATTTCAAGAATCCTTCAGTTGACATGACCGCGAAAGC
ATCCGACTCGCAGGAGTCAAAACGGGAAATTTATGAGTATCCCGCTCTCCATGTTACGCAAGAGAGGGGT
AGCGCACTTGCCAGAGCCCACAGGGAAGGACTCAAGACAATGCAGAAGCAGGGTCATGGCCAGAGTTCGT
CCTGTCGACTGACGCCAGGGTACAACTTTGCTCTCATTGGCCACGATTCAGCGAGCCTGAACATTGAATA
TCTCATTGTGGACGTTTCTCATTCGGGCACTCAACCCCAGTCGCTCGAGGAGATGTCCCAAGGGCCTTTC
TCGTACGGCAACAGTTTTACTGTCATTCCGGCAACAACCCCGTTCCGCCCCACTGCCACTCGACAAAAGC
CCATAGTAAAAGGGATTCAGACCGCTATCGTGGTTGGTCCCAAGGGCGAAGAGATCTACGCCGATGAGTA
TGGTCGGATAAAGGTTCAGTTCCATTGGGACAGGGAAGGCCGCCGTGACGAGAAGAGTTCCTGCTGGCTC
CGCATAGGGCAGACTTGGAGTGGAAACGGTTGGGGCATGATTAACATCCCCCGGATTGGAGACGAGGTAC
TGGTCGACTTTATCGATGGAGATCCGGATCGTCCCATTATCGTCGGCAGCGTCAACAACGCCGAATCTCC
CGCACTCTTTTCCCTCCCCGCCAACAAAACCCAAAGCGGCATCCGTACCCGCAGCTATCCCAACGGCGGC
CGCGACAACTACCACGAACTTCGCTTCGAAGACAAAAAGGGTAGCGAGGAGATCTACCTTCAGAGTGAGA
AGGACTGGAACATCCTGGTTAAGAACGACAAGACCCAGAATGTTGAACACGACGAGGCTCTACATGTGGC
AAACAACCGGCTGAAGACCGTCGGAGTTGACCAGATGGTGCAGGTGGGAGCCAACCACACCGAAATCATC
GGTGCCAATAAGAGTATTTCCGTCGGCTCAAACAAGACCGAGACGGTGGGGCTCAACTCTGCGGAAACGG
TTGGGCTTGCCAAGGAGCTGACCATCGGCGGACTTTATCAGGTCAGCGTCGGTGGGGTCATGAACGAGAC
CGTCATCGGCGCCAAGGCCGAGGAAGTGGGGGTGACCAAGGCGGTGCTGGTCGGCGCTCACATGACCGAG
AAGGTGGCCGGGAACCGCTCGCTCACCGTGGGGCAGAACCTCTCGGCAACGGTCAGCCAGAACACCACCG
TGAAGGCCAAGGCGATAGTTCTGGAAGCCGATGACGAGATCATCTTCAAGACGGGCAGCTCTACCATCTC
CCTGAAATCCAGCGGCGAGATTGTCGTTACGGGAGCGACCATAACCGAGAAAGCCAGCGGTGAAATCGTT
ATAAAGGGTGCCAGGACTTCGGTGAATTGA