SecReT6
Protein ID: 78224501
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3310
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3725357..3725911 [+]
Productlipoprotein
NoteTssJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-27, Aligned region: 15..169
Protein Sequence: 184 a.a.     [Download]
>gi|78224501|ref|YP_386248.1| unnamed protein product [Geobacter metallireducens GS-15]
MKRRAALLLYVSAIASLCSCTSTPKATPPLDWGYEKEAISVTLKGDPQLNLFQKSPHALVACLYQLRDPN
AFNQFRTEPDGLTKLLECGRFDPGVATAKRMVIQPGQEVNESLDRAEGARYVGFVAGYYRLDKDRSARLY
TIPSVEETKGFLSRTKLVKPGRLDMKLLLGPQEIQDVTEETEKP
 
Nucleotide Sequence: 555 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3725357-3725911 Geobacter metallireducens GS-15 chromosome, complete genome
ATGAAGCGTCGAGCCGCTTTGCTGCTCTATGTATCCGCCATAGCATCGCTTTGTTCCTGCACCTCCACTC
CGAAGGCAACGCCTCCGCTGGATTGGGGCTACGAAAAGGAGGCGATCTCCGTCACCCTGAAGGGGGACCC
GCAGCTGAATCTCTTCCAGAAGAGTCCCCACGCTCTCGTGGCCTGCCTCTACCAGCTCCGGGACCCCAAT
GCCTTCAACCAGTTCCGCACCGAGCCCGACGGCCTGACCAAGCTTCTGGAGTGCGGCCGCTTCGATCCGG
GAGTGGCGACCGCCAAGCGGATGGTGATCCAGCCGGGACAAGAGGTGAACGAGTCCCTGGACCGAGCCGA
AGGGGCCCGCTACGTGGGGTTCGTTGCCGGCTACTACCGCCTTGACAAGGATCGCTCGGCACGGCTCTAC
ACCATCCCCTCAGTGGAAGAGACCAAGGGTTTCCTCAGCCGGACCAAACTCGTGAAACCGGGACGGCTTG
ACATGAAACTCCTCCTAGGTCCCCAGGAGATCCAGGACGTGACTGAGGAGACCGAAAAACCATGA