SecReT6
Protein ID: 78224502
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3311
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3725908..3727299 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-102, Aligned region: 19..460
Protein Sequence: 463 a.a.     [Download]
>gi|78224502|ref|YP_386249.1| unnamed protein product [Geobacter metallireducens GS-15]
MTAHPPVHWHQGLFLQPQHFQLLDLSIQGRLAPLFSYLHPHFWGAGELEIEESALGTGIFSILSGEFLFP
DGTWAVLGENALCEPRSFDSAWLEGDKPLMVSVGIRKWQEAGENVTTVERLEGLSAVSTRFAAPMDPEEA
RDLHAGGPPGQVKRLRHMIKIFWDSEREQLGDWHLIPVARLERFGAEVRLSRRFIPPSLALEASEPLFRI
IREIRDQVAARGRQLEEHKKQRGIQNAEFGSRDLVYLLALRSLNRHVPYLFHLTEARRVHPWDAYGALRQ
LIGELASFSERVSALGELDDGVRLLPPYDHRALGECFAGARDLIAQLLDEITAGPNYVIRLLHDGTFFSA
ELKPAVFDGGSRYYLALRTKEEPTTFLPSLETSAKLSAREHLPVLASRALPGIELAHMPVPPQELPRRSD
THYFAVDAAGDQWPLVEREHTLALYWTSAPADLEVELMVVARD
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3725908-3727299 Geobacter metallireducens GS-15 chromosome, complete genome
ATGACCGCCCACCCCCCAGTCCACTGGCACCAGGGGCTCTTTCTCCAGCCCCAGCATTTCCAGCTTCTTG
ACCTGTCAATCCAGGGGCGCCTCGCCCCCCTCTTCAGCTATCTCCACCCCCATTTCTGGGGGGCCGGGGA
GTTGGAGATCGAGGAGAGCGCCCTCGGCACCGGGATCTTCAGCATCCTCTCGGGAGAATTTCTCTTCCCC
GACGGCACCTGGGCGGTCCTGGGCGAAAACGCCCTATGCGAGCCCCGCTCCTTCGACAGTGCCTGGCTTG
AGGGGGATAAACCCCTCATGGTCTCCGTCGGTATCCGCAAATGGCAGGAAGCGGGGGAAAACGTGACGAC
GGTGGAGCGTCTGGAGGGGCTTTCGGCCGTCTCCACCCGTTTTGCGGCCCCCATGGACCCGGAGGAGGCA
CGGGATCTCCACGCCGGTGGTCCCCCGGGGCAGGTAAAGCGGCTGCGGCATATGATCAAGATCTTCTGGG
ACAGCGAGCGAGAGCAGCTGGGGGACTGGCACCTAATTCCCGTGGCCCGGCTGGAGCGCTTCGGGGCCGA
GGTGCGCCTCTCCCGGCGATTCATCCCCCCTTCCCTGGCCCTGGAAGCCAGCGAACCACTCTTCCGCATC
ATCCGGGAAATCCGGGACCAGGTGGCGGCCCGGGGGCGGCAGCTGGAGGAGCACAAGAAGCAGCGGGGGA
TCCAGAACGCCGAGTTCGGCTCCCGGGACCTGGTCTACCTCCTGGCGCTCCGCTCCCTGAACCGCCATGT
ACCGTACCTCTTCCACCTGACCGAGGCCAGGCGGGTCCACCCCTGGGACGCCTACGGTGCCCTGCGTCAG
CTCATCGGCGAGCTGGCCTCCTTCTCGGAGCGGGTTTCGGCCCTGGGAGAGCTGGACGACGGGGTCCGCC
TCCTTCCCCCCTACGACCACCGGGCCCTGGGAGAGTGCTTCGCCGGGGCCCGGGACCTGATCGCCCAGCT
CCTGGACGAGATCACCGCCGGTCCCAACTACGTGATCCGCCTCCTCCACGACGGCACTTTCTTCAGCGCC
GAGCTGAAACCTGCGGTATTCGACGGCGGCAGCCGCTACTACCTGGCCCTGCGCACCAAGGAAGAGCCAA
CCACCTTCCTCCCCTCCCTGGAAACCTCCGCCAAGCTCAGCGCCCGGGAGCACCTGCCGGTCCTGGCGTC
ACGGGCACTCCCCGGCATCGAATTGGCCCACATGCCGGTTCCGCCCCAGGAGCTGCCGCGCCGTTCCGAC
ACCCACTACTTCGCCGTGGACGCCGCCGGCGACCAGTGGCCCCTGGTGGAGCGGGAGCACACACTGGCCC
TCTACTGGACCAGCGCCCCCGCCGACCTGGAGGTGGAGCTGATGGTGGTGGCGCGAGACTAA