SecReT6
Protein ID: 78224503
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3312
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3727303..3727713 [+]
Producthypothetical protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-22, Aligned region: 27..116
Protein Sequence: 136 a.a.     [Download]
>gi|78224503|ref|YP_386250.1| unnamed protein product [Geobacter metallireducens GS-15]
MRDERLLERIRSFERDPARRGRPDHGRLVESVLAHLRQILNTRQGSAPIAPDYGVPDFLDFLQTYPDSVR
EIERSIRVAIQTYEPRLDGVRVAFIPQEDDVLALRFQITARITDDDGGTVRFETVVDTDGKIAVKR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3727303-3727713 Geobacter metallireducens GS-15 chromosome, complete genome
ATGCGCGACGAACGTCTTCTGGAACGGATCCGCTCCTTCGAGCGGGACCCGGCCCGGCGCGGCCGCCCCG
ACCACGGGCGGCTGGTGGAGTCGGTCCTGGCTCACCTGCGCCAGATTCTCAACACTCGCCAGGGGAGCGC
CCCCATTGCCCCCGACTACGGGGTCCCCGATTTTCTCGACTTCCTCCAGACCTACCCCGACTCGGTGCGG
GAGATCGAGCGGAGCATCCGCGTCGCCATCCAGACCTACGAGCCCCGCCTCGACGGGGTGCGGGTCGCCT
TCATCCCCCAGGAAGACGACGTCCTGGCGCTCCGGTTCCAGATCACCGCCCGGATCACCGATGACGATGG
GGGTACGGTCCGCTTCGAGACCGTGGTGGACACCGACGGCAAGATCGCAGTCAAACGCTGA