SecReT6
Protein ID: 78224504
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3313
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3727743..3729473 [+]
Producthypothetical protein
NoteTssF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-176, Aligned region: 3..576
Protein Sequence: 576 a.a.     [Download]
>gi|78224504|ref|YP_386251.1| unnamed protein product [Geobacter metallireducens GS-15]
MITRHYQEELARLKELGSEFAQRHPALAPMLGGTSTDPDVERLLEGVAFQTALLRRKLDDDFPELVHDMV
RLVAPHYLRPIPATTIVAFEPKPSLVQPQTVPAGMQLASVPVEGTRCHFRTTSPVEVHPLTLQDASFDQP
AGRPPAVTLRLALTGLTLGQWAPQSLRLFLAAGEAEAAELYLLLARSVSRIVIAPAEGGTGTVLPANCLR
PAGLNGNEPLIPYPPNAFPGYRLLQEYLTAPRRFFFLELTGWDQWRGRGNGTRFSVTFELLNAPAQAPRV
SRESIALFATPAVNLFSHDADPIPLDHRKERHLLRPAELPPGHAEVFSVDRVTAFERGTSREYHLDPFEA
FRTPADGRPSYHTSIAQSPFKDGCDVRLALAYPPGTVPPEGTTLSVGLTCTNGRLPESLRVGDVAEPTRD
APTFASFRNITPVTPSSPPPLGPNLLWRLLSAIPLSRLSVAHADNLRECLGLYLFPGFDRTLLAANRRRI
EGIERVATRQTDRIVRGAPMRGVEIAIDIRGDHFAGPGDLFLFGSVLDEFMAGSATLNTFTRLTIRETVR
GEEFQWPPRAGYQPLL
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3727743-3729473 Geobacter metallireducens GS-15 chromosome, complete genome
ATGATCACCCGCCACTATCAGGAAGAACTGGCCCGCCTCAAGGAGCTGGGGAGTGAGTTCGCCCAACGGC
ACCCGGCCCTGGCGCCGATGCTCGGGGGCACCTCGACCGACCCTGACGTGGAACGGCTTCTGGAGGGAGT
AGCCTTCCAGACGGCGCTCCTGCGCCGGAAGCTGGATGACGATTTCCCCGAATTGGTCCACGACATGGTG
CGGCTTGTGGCCCCCCACTACCTGCGACCCATCCCCGCCACCACCATCGTCGCCTTCGAACCGAAGCCCT
CCCTGGTCCAGCCCCAGACGGTGCCGGCCGGGATGCAGCTCGCCTCGGTGCCGGTGGAGGGGACCCGCTG
CCACTTCCGGACTACGAGCCCCGTGGAGGTGCACCCCCTCACCCTCCAAGACGCCTCCTTTGACCAGCCG
GCCGGCCGCCCCCCGGCCGTGACCCTCCGACTGGCCCTCACGGGGCTCACCCTCGGCCAGTGGGCGCCCC
AATCCCTGCGGCTCTTCCTGGCGGCCGGGGAGGCCGAGGCGGCGGAGCTCTACCTCCTCCTCGCCCGCTC
CGTTTCCCGCATCGTCATCGCCCCAGCCGAGGGGGGAACGGGGACCGTCCTGCCGGCCAACTGCCTCAGA
CCCGCGGGGCTCAACGGAAATGAGCCCCTCATCCCCTACCCCCCCAACGCCTTCCCCGGCTACCGGCTCC
TCCAGGAGTACCTGACGGCCCCCCGCCGCTTCTTCTTCCTGGAGCTGACCGGCTGGGACCAGTGGCGGGG
ACGGGGCAACGGCACCCGGTTCAGCGTCACCTTCGAACTGCTAAACGCGCCGGCCCAAGCGCCCCGAGTC
AGCCGGGAGAGCATCGCCCTCTTCGCCACCCCGGCCGTCAACCTCTTCTCCCACGATGCCGACCCGATCC
CCCTGGACCACCGGAAGGAGCGCCACCTCCTGCGGCCAGCCGAACTGCCCCCCGGTCACGCCGAGGTCTT
TTCCGTGGACCGGGTCACCGCCTTCGAGCGGGGCACTTCCCGGGAGTACCACCTAGACCCCTTCGAGGCA
TTCCGGACCCCGGCCGACGGCCGCCCCAGCTACCACACGTCCATCGCGCAATCCCCCTTCAAGGACGGCT
GCGACGTCCGCCTCGCCCTCGCCTATCCGCCGGGCACGGTACCCCCAGAGGGGACGACCCTGTCGGTGGG
GCTCACCTGCACCAACGGGCGACTCCCCGAAAGCCTCCGGGTCGGCGACGTGGCGGAACCCACCCGGGAT
GCGCCGACCTTTGCCTCGTTCCGGAACATCACCCCCGTCACCCCATCGTCCCCTCCCCCCCTGGGGCCGA
ACCTCCTCTGGCGGCTCCTCTCGGCCATTCCCCTGAGCCGCCTCTCCGTGGCCCACGCCGACAACCTGCG
GGAGTGCCTCGGCCTCTACCTCTTCCCCGGCTTCGACCGGACCCTCCTTGCGGCCAACCGGCGCCGGATC
GAGGGGATCGAACGGGTCGCGACCCGGCAGACGGACCGCATCGTGCGCGGCGCCCCCATGCGGGGGGTGG
AGATCGCCATTGATATCCGGGGCGACCACTTCGCGGGACCGGGGGACCTCTTCCTCTTCGGGTCGGTCCT
CGATGAATTCATGGCGGGGAGCGCCACCCTCAACACCTTCACGCGCTTGACCATCCGCGAAACCGTGCGG
GGAGAGGAGTTCCAGTGGCCGCCGCGAGCCGGATACCAGCCGCTCCTCTAG