SecReT6
Protein ID: 78224505
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3314
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3729437..3730426 [+]
Producthypothetical protein
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-78, Aligned region: 20..306
Protein Sequence: 329 a.a.     [Download]
>gi|78224505|ref|YP_386252.1| unnamed protein product [Geobacter metallireducens GS-15]
MAAASRIPAAPLEQELLHRGHEFSFLQVLRILELLGERDGTKRPVEVIPRLSLGFPAADVAGVERVGDGY
RVIATFLGLYGQATPLPAFYTEELLDEEATDSSAGRDFLDIVNRHIYGIFANVARKYRLFLQVDEQRSDA
VTERLHALGGYGEETLRAQLPDPRSLLRYTGLFAQHPRSALGLRTLLTDALDAPVEVISAVPRIVTVPPE
ERSRLGTIGTLGEDAFVGSEIPDRSGMFRIEVGPLRRDRFAELLPGTPERKRLDLLVALYITDPLAYEIE
LILAPGEAPPAMLGSGIRLGWDVWMTSGADVGRVSVSFPGGGEPLAAPR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3729437-3730426 Geobacter metallireducens GS-15 chromosome, complete genome
GTGGCCGCCGCGAGCCGGATACCAGCCGCTCCTCTAGAGCAGGAACTCCTCCACCGGGGGCACGAATTCT
CATTCCTCCAGGTGCTCCGGATCCTGGAGCTTCTCGGAGAACGGGACGGGACCAAACGGCCCGTGGAGGT
GATCCCCCGGCTCTCCCTGGGCTTTCCGGCCGCGGACGTAGCCGGGGTGGAGCGGGTCGGCGACGGCTAT
CGGGTCATTGCCACGTTCCTGGGGCTCTACGGCCAGGCGACCCCGCTTCCCGCCTTCTACACCGAGGAAC
TTCTCGACGAGGAAGCCACCGACAGCAGCGCCGGCCGGGATTTCCTCGACATCGTCAACCGGCACATCTA
CGGCATCTTCGCGAATGTTGCCCGGAAATACCGGCTCTTTCTCCAGGTGGACGAGCAGCGCAGCGACGCC
GTCACGGAGCGGCTCCACGCCCTCGGGGGGTACGGCGAAGAAACGCTTCGGGCCCAACTCCCCGATCCCC
GGTCGCTCCTGCGCTACACGGGGCTCTTCGCCCAACACCCCCGCTCGGCCCTGGGGTTGCGGACGCTGCT
GACCGATGCCCTCGACGCGCCGGTGGAGGTAATCTCCGCCGTCCCCCGCATCGTGACGGTACCGCCGGAG
GAGCGCTCACGCCTCGGCACCATCGGCACCCTCGGCGAGGACGCCTTTGTGGGCTCCGAGATCCCCGACC
GCTCCGGCATGTTCCGCATTGAGGTGGGTCCCTTGCGCCGCGACCGGTTCGCCGAACTCCTCCCCGGCAC
CCCGGAGCGCAAGCGCCTCGACCTCCTCGTCGCCCTCTACATCACCGACCCCCTCGCCTACGAAATCGAG
CTGATCCTCGCCCCCGGCGAGGCCCCGCCGGCCATGCTCGGCAGCGGCATTCGGCTCGGATGGGATGTGT
GGATGACGTCAGGGGCGGATGTGGGGCGGGTGTCGGTGAGCTTTCCCGGCGGAGGGGAGCCCCTCGCGGC
ACCTCGTTAA