SecReT6
Protein ID: 78224506
SecReT6 ID108
T6SS typeN/A
Gene symbol-
Locus tagGmet_3315
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]3730457..3733093 [+]
ProductAAA ATPase
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-39, Aligned region: 219..238
AAA_2 [PF07724], Evalue: 3.10E-39, Aligned region: 604..769
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 221..333
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 609..726
ClpB_D2-small [PF10431], Evalue: 3.90E-13, Aligned region: 775..845
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 221..241
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 608..724
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 198..238
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 266..299
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 447..486
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 579..632
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 674..701
AAA_16 [PF13191], Evalue: 6.80E-11, Aligned region: 749..808
Clp_N [PF02861], Evalue: 2.40E-08, Aligned region: 25..75
Clp_N [PF02861], Evalue: 2.40E-08, Aligned region: 117..123
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 220..302
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 606..627
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 669..702
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 199..233
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 274..373
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 606..621
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 679..690
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 218..242
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 415..429
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 606..630
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 215..244
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 608..626
Sigma54_activat [PF00158], Evalue: 5.00E-05, Aligned region: 217..236
Sigma54_activat [PF00158], Evalue: 5.00E-05, Aligned region: 608..723
NACHT [PF05729], Evalue: 0.00021, Aligned region: 221..248
NACHT [PF05729], Evalue: 0.00021, Aligned region: 417..438
NACHT [PF05729], Evalue: 0.00021, Aligned region: 608..649
AAA_18 [PF13238], Evalue: 0.00054, Aligned region: 221..244
AAA_18 [PF13238], Evalue: 0.00054, Aligned region: 609..642
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 221..245
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 607..643
AAA_25 [PF13481], Evalue: 0.00059, Aligned region: 221..245
AAA_25 [PF13481], Evalue: 0.00059, Aligned region: 434..465
AAA_25 [PF13481], Evalue: 0.00059, Aligned region: 606..640
ResIII [PF04851], Evalue: 0.0018, Aligned region: 212..242
ResIII [PF04851], Evalue: 0.0018, Aligned region: 291..302
ResIII [PF04851], Evalue: 0.0018, Aligned region: 607..643
AAA_29 [PF13555], Evalue: 0.0052, Aligned region: 215..233
AAA_29 [PF13555], Evalue: 0.0052, Aligned region: 606..633
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 219..239
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 440..474
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 607..649
Protein Sequence: 878 a.a.     [Download]
>gi|78224506|ref|YP_386253.1| unnamed protein product [Geobacter metallireducens GS-15]
MLTVDLKALISRLNPHCSGALEGAAGLCVARGHYEVTVEHLLARLLDEPGGDLPLILRAFEVDAASVKAG
ITRVLDELPSGNSGKPVFSPVLLEWLQAAWLITSLDLNEERIRSGALLLALLARPLQLTAGRYVDLLMAV
GRETLLSRFGTATAGSVEHAPTSVRSATSDEAPKGTTSLDRFCTDFTRQAAEGNIDPVFGRDREIGQMVD
ILARRRKNNPIIVGEAGVGKTAVAEGLALRIVEGDVPEALREVRLLGLDLGLLQAGAGVKGEFENRLKSV
IEEVKGSPRPIILFIDEAHTIIGAGGQTGGGDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALARR
FQPVKLDEPDVETAVLILRGLKEKYEAAHGVTIRDDGIRAAAELSSRYLSGRQLPDKAVDLLDTAAARVK
LLLTGKPGAVEEKERRIQALEREEAAMARDQLHGRPVDDERLDLLKAELLTLREELAAVTARWHREQELA
AEVMALRKELSTEAEENEDRRGLKRQVTEATARLAEFQGDAPLVRIEVEPEVVARVVADWTGIPLGSLQK
DRAAGVLTLEGDLRRRIKGQEPALSAVAEVLRSSAAGLKDPRQPLGVFLLVGPSGVGKTETALAVADLLF
GGERFLTVINMSEFQERHTTSRLIGSPPGYVGYGEGGVLTEAVRRQPYSVVLLDEVEKAHPDVMNLFYQV
FDKGMLADGEGRVIDFANTVIFLTSNLASDVITSLCCGDQAPTAEGLTSAIRPHLSRHFKPALLARMSVV
PYLTLAPEYLGEIVTLKLGRVAERLRENSRTALSWTPAVTERIAARCTEVESGARTIDHILRSTLLPLLS
REILPRLGTGETPEAIRLDTTADGDFAVTFDTSGGMEQ
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|78221228|ref|NC_007517.1|:3730457-3733093 Geobacter metallireducens GS-15 chromosome, complete genome
ATGCTGACCGTTGACCTTAAAGCCCTCATATCCCGCCTCAATCCCCACTGTTCCGGCGCCCTGGAAGGGG
CGGCGGGGCTTTGCGTGGCCCGGGGCCACTACGAGGTGACCGTGGAGCACCTCTTGGCGCGGCTTCTGGA
CGAGCCGGGGGGTGACCTCCCCCTCATCCTCCGGGCCTTCGAGGTGGATGCCGCATCCGTGAAGGCCGGG
ATCACCAGGGTCCTCGACGAGCTTCCCTCCGGGAACTCGGGGAAGCCGGTCTTCTCGCCGGTGCTTCTGG
AGTGGCTCCAGGCAGCGTGGCTCATCACCTCCCTCGACCTCAACGAAGAGCGGATCCGCTCCGGCGCGCT
GCTGCTGGCGCTCCTGGCCCGGCCGCTCCAGCTCACGGCGGGCCGCTACGTGGACCTTCTAATGGCCGTG
GGGAGGGAGACGCTCCTCTCCCGCTTCGGCACGGCCACGGCCGGTTCGGTGGAGCATGCACCGACCAGTG
TCCGCTCCGCAACCAGCGACGAGGCACCCAAGGGAACCACCTCTCTCGACCGCTTCTGCACCGATTTCAC
CCGCCAGGCGGCGGAAGGTAATATCGACCCGGTCTTCGGCCGGGACCGGGAGATCGGCCAGATGGTCGAC
ATCCTGGCCCGGCGCCGGAAGAACAACCCCATCATCGTCGGCGAGGCGGGGGTCGGGAAGACCGCCGTAG
CCGAAGGGCTTGCACTTCGGATTGTGGAGGGGGACGTGCCGGAGGCCCTCCGGGAGGTACGGCTCCTGGG
GCTCGATCTGGGGCTTCTCCAGGCGGGGGCCGGAGTGAAGGGTGAGTTCGAGAACCGCTTGAAAAGCGTC
ATCGAGGAGGTGAAGGGGTCGCCGCGCCCCATCATCCTCTTCATCGACGAGGCCCATACCATCATCGGCG
CCGGGGGGCAGACCGGCGGAGGTGACGCCGCTAACCTCCTGAAACCGGCCCTGGCCCGAGGGGAACTGCG
GACCATCGCCGCCACCACCTGGAGCGAGTACAAGAAATATTTCGAAAAGGACGCGGCCCTGGCCCGGCGC
TTCCAGCCGGTGAAGCTGGACGAGCCGGACGTCGAGACCGCCGTCCTGATCCTGCGGGGTCTCAAGGAGA
AGTACGAGGCGGCCCACGGGGTCACCATCCGGGACGACGGCATCCGGGCGGCGGCGGAGCTTTCTTCCCG
CTACCTGTCGGGGCGCCAGCTCCCGGACAAGGCAGTGGACCTCCTGGATACGGCGGCGGCCCGGGTGAAG
CTCCTTCTCACCGGGAAGCCGGGGGCCGTGGAGGAGAAAGAGCGCCGCATCCAGGCTCTGGAGAGGGAAG
AGGCGGCCATGGCCCGGGACCAGCTCCACGGCCGCCCCGTTGACGACGAGCGACTGGATCTCCTGAAGGC
GGAATTGTTAACCCTGCGGGAGGAGTTGGCCGCCGTCACGGCGCGGTGGCACCGGGAACAGGAGCTGGCC
GCGGAAGTGATGGCCCTTCGCAAGGAACTGTCGACGGAAGCGGAAGAAAACGAAGATCGGCGAGGACTGA
AACGGCAGGTGACCGAGGCCACGGCTCGCCTAGCGGAGTTCCAGGGTGACGCCCCATTGGTACGGATCGA
GGTGGAGCCGGAGGTGGTGGCCCGGGTGGTGGCCGACTGGACAGGCATCCCCCTGGGGAGCCTCCAGAAG
GACCGGGCCGCCGGGGTCCTCACCCTGGAGGGCGACCTGCGCCGCCGCATCAAGGGGCAGGAGCCGGCCC
TCTCCGCCGTGGCCGAGGTGCTCCGCTCCTCGGCGGCAGGGCTCAAGGACCCACGCCAGCCCCTGGGAGT
TTTTCTCCTGGTGGGGCCGTCGGGGGTCGGGAAGACCGAGACGGCCCTGGCCGTGGCCGACCTCCTCTTC
GGGGGGGAGCGGTTCCTCACGGTCATCAACATGAGCGAGTTCCAGGAGCGCCACACCACGAGCCGCCTCA
TCGGCTCGCCGCCGGGGTACGTGGGGTACGGCGAGGGGGGGGTCCTCACGGAGGCGGTCCGGCGCCAGCC
CTACTCGGTGGTCCTCCTGGACGAAGTGGAGAAGGCCCACCCCGACGTCATGAACCTCTTCTACCAGGTC
TTCGACAAGGGGATGCTGGCCGACGGCGAGGGGCGGGTCATCGACTTCGCCAACACAGTCATCTTCCTCA
CGAGTAACCTGGCCTCGGATGTCATCACCTCCCTCTGTTGCGGGGATCAAGCACCGACGGCGGAGGGGCT
GACCTCCGCCATCCGCCCCCACCTCTCCCGACACTTCAAGCCGGCGCTCCTGGCCCGGATGTCGGTGGTC
CCCTACCTGACCCTGGCCCCCGAGTACCTGGGGGAGATCGTTACCCTGAAGCTGGGGCGGGTGGCGGAGC
GGCTCCGGGAGAACAGCCGAACGGCGCTTTCTTGGACCCCGGCGGTCACGGAACGGATCGCGGCCCGCTG
CACCGAGGTGGAGAGCGGCGCCCGGACCATCGACCATATCCTACGGAGCACGCTGCTGCCGCTTCTCTCC
CGGGAAATTCTCCCCCGGCTCGGCACCGGCGAGACGCCGGAGGCTATCAGGCTCGACACGACGGCCGACG
GCGACTTTGCCGTCACCTTTGATACCAGTGGAGGCATGGAACAATGA