SecReT6
Protein ID: 827372802
SecReT6 ID948
T6SS typei1
Gene symbol-
Locus tagU876_13545
StrainAeromonas hydrophila NJ-35
Repliconchromosome [GenBank: CP006870] [Browse all T6SS(s) in this replicon]
Location [Strand]2959473..2960807 [-]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 444 a.a.     [Download]
>gi|827372802|ref|AKJ34989.1| hypothetical protein [Aeromonas hydrophila NJ-35]
MSSRNRVIWREGLFIKPQHFQQQQRHSDYALHARLSALSDYFYGLQSLAINEDYLGFGRIALVGATGILP
DGTVFNIPNDDVLPTPLEVTDASVANQKVYLALPLSVSGVNEVNQGGQVATRLQAHRHDVRDLHSEGGDV
VSLEVGRVSLRLMLEREDRSAYASLAIARILDKRPDGGLVLDPNFMPCSISVSAIPTLKRFLGESAGLVA
ERARSLSQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDESR
LPPEFPAYRHDDQQVSFEPVMLALRQALSTVLSPRAVSIQLRKHQYGIMVAMVNESELMTSADFVLAVRA
RMPQEQLRKQLLQQTKVASSDKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQMLAVG
NTLAFHIAGDFPELDMQLWAIRSQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|827370414|ref|CP006870.1|:c2960807-2959473 Aeromonas hydrophila NJ-35, complete genome
ATGTCGAGTCGAAATCGGGTTATCTGGCGTGAGGGGTTGTTCATCAAGCCCCAGCACTTCCAGCAACAAC
AAAGACATTCGGATTACGCGCTGCACGCTCGCCTGAGCGCGCTGTCCGACTATTTCTATGGCTTGCAGTC
GCTCGCCATCAACGAGGATTACCTGGGCTTTGGCCGCATCGCCCTGGTGGGGGCCACCGGCATCCTGCCG
GACGGTACCGTGTTCAACATCCCCAATGACGATGTGCTGCCGACCCCGCTGGAAGTCACCGACGCCTCGG
TGGCCAACCAGAAGGTCTATCTGGCGCTGCCGCTCTCAGTGAGCGGTGTCAACGAGGTCAATCAGGGCGG
CCAGGTGGCTACCCGGTTGCAGGCCCATCGCCATGACGTGCGCGATTTGCACAGCGAAGGGGGGGATGTG
GTCTCCCTCGAAGTGGGGCGGGTCAGCCTGCGGCTGATGCTGGAGCGCGAGGATCGCAGTGCTTATGCAT
CATTGGCCATCGCCCGCATTCTGGACAAGCGCCCGGACGGCGGCCTGGTGCTGGATCCCAACTTCATGCC
CTGCAGCATCAGCGTCTCCGCCATCCCGACCCTCAAGCGCTTCCTCGGCGAGTCGGCCGGGTTGGTCGCC
GAGCGGGCCCGTAGTCTCTCCCAGCGCATCGCCGCGCCGGGTCAGCAGGGAGTGGCCGACGTGGCCGAGT
TCATGATGCTGCAACTGCTCAACCGGGCCCAGCCCCAGCTCTCCCATCTGGCGCGCCTTGGCACTCTGCA
CCCCGAGCGGTTGCACGAGGCGCTGGTGCAGCTGTGTGGCGAGCTGATGACCTTTACCGACGAGTCCCGC
CTGCCGCCCGAGTTCCCCGCCTATCGCCACGACGATCAGCAGGTGAGCTTCGAGCCGGTGATGCTGGCCC
TGCGCCAGGCGCTCAGTACCGTGCTGTCGCCGCGCGCCGTCTCCATCCAGCTGCGCAAGCACCAGTACGG
CATCATGGTCGCCATGGTCAACGAGAGCGAGCTGATGACCAGCGCCGACTTCGTGCTGGCGGTGCGTGCC
CGCATGCCGCAGGAGCAGCTGCGCAAGCAGTTGCTGCAGCAGACCAAGGTGGCCTCCAGCGACAAGATCC
GCGAGCTCATCAGCCTGCAGCTGCCCGGCATTCCGCTGCTGCCGCTGCCGGTGGCGCCGCGCCAGCTGCC
CTATCACGCCGGTTACAGCTACTTCCAGCTCGACCGGCAGAGCCCGGCCTGGCAGATGCTGGCGGTGGGC
AACACCCTTGCCTTCCACATCGCCGGCGACTTCCCCGAGCTCGACATGCAGCTCTGGGCCATTCGCAGCC
AGTGA