SecReT6
Protein ID: 827372809
SecReT6 ID948
T6SS typei1
Gene symbol-
Locus tagU876_13580
StrainAeromonas hydrophila NJ-35
Repliconchromosome [GenBank: CP006870] [Browse all T6SS(s) in this replicon]
Location [Strand]2967319..2967822 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 167 a.a.     [Download]
>gi|827372809|gb|AKJ34996.1| type VI secretion protein [Aeromonas hydrophila NJ-35]
MGKNIDGATVAPKERINIKYVPATGGQQGEVELPLTMMVVGNMKGRTEDTPIEERQTVSIDKNNFSSVMK
ESALELKFSVPNRLEENSQDALPVSINIQSLEDFTPDRVAQQIPELRKLLELREALVALKGPLGNIPAFR
NRLQDLLSSDEAREQLLKELDLIKPAE
 
Nucleotide Sequence: 504 bp     [Download]