SecReT6
Protein ID: 83646943
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04246
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4389751..4391028 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ2SEH1
KEGG IDhch:HCH_04246
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-25, Aligned region: 64..125
Protein Sequence: 425 a.a.     [Download]
>gi|83646943|ref|YP_435378.1| hypothetical protein HCH_04246 [Hahella chejuensis KCTC 2396]
MASDNIIELEPFFSPISDENPSGTDLRDENDSDFSAAKAARRKVVSLAKAARFDANGELELVEQWREIRR
LAPTILKRKSKDLEVAAWFTEALLKLEGFTGLRDGLQIIKGLVENFWDTIYPLPDEDGVETRIYPLISLN
GEDGTGTLVLPIKNTPLTDDTENVLTLTSYGRLQDALDIEDPEERIRRFEELSLSEDIVNQQLLTVSPDK
AQNVYEDIQEALALWQEIGELVDAKCAESGSKASLPTSGVKNALQEVEELYKRLMKNKLLSDDEEAPIQT
NDGQSGGNTGGGGGQQMRGGVAHGPFRSREDAINHLLVVAEYFRKTEPHSPLCGAIERAASWGRMSIQEL
LMELIPDEEARARYALMTGIQIGEDAAPIGQLSQTARAVTIPEPKAKAEGASEPEQGTDNDWNNSGGGGS
GDSSW
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4389751-4391028 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGGCGTCTGACAATATTATTGAGTTAGAGCCTTTCTTCTCGCCAATCAGTGACGAGAATCCATCCGGAA
CCGACCTAAGAGATGAAAACGACAGTGACTTCAGCGCCGCCAAGGCCGCACGTCGCAAAGTCGTATCTCT
GGCCAAGGCTGCGCGCTTTGACGCCAACGGTGAACTGGAACTGGTTGAACAATGGCGGGAAATCCGTCGT
CTCGCCCCGACGATTCTTAAACGCAAAAGCAAAGACCTTGAAGTCGCCGCCTGGTTTACCGAGGCGTTAC
TGAAACTGGAAGGCTTCACCGGACTTCGCGACGGCCTTCAGATCATTAAAGGCTTGGTCGAAAACTTTTG
GGACACTATCTACCCGCTTCCTGACGAAGACGGCGTGGAAACCCGCATTTATCCGCTGATATCGCTCAAT
GGCGAAGACGGCACAGGCACCCTGGTCCTGCCAATCAAAAATACGCCGTTGACCGACGACACGGAAAACG
TGCTGACGCTTACCTCTTACGGTCGCCTTCAGGACGCTCTGGATATCGAAGATCCGGAAGAGCGCATCCG
TCGCTTTGAAGAGCTGAGTCTCAGTGAAGATATCGTTAACCAGCAGCTCCTCACTGTAAGCCCTGACAAA
GCGCAGAATGTATATGAAGATATTCAGGAAGCGCTGGCGTTATGGCAGGAGATCGGAGAACTGGTCGACG
CCAAGTGCGCAGAAAGCGGCAGCAAAGCCAGCCTCCCCACCAGCGGCGTTAAGAATGCGCTGCAGGAAGT
CGAGGAGCTGTATAAGCGACTGATGAAAAACAAGCTGCTTTCTGATGATGAAGAAGCGCCGATACAAACC
AATGACGGCCAATCAGGCGGGAACACTGGCGGTGGAGGCGGTCAGCAAATGAGAGGCGGCGTTGCGCATG
GTCCCTTCAGAAGCCGTGAAGACGCCATCAATCATCTGTTGGTGGTCGCCGAATACTTCCGCAAGACAGA
ACCGCACTCCCCCCTCTGCGGAGCCATTGAAAGAGCCGCCAGCTGGGGTAGAATGTCTATTCAAGAACTG
CTCATGGAGCTGATACCTGACGAAGAAGCGCGGGCGCGCTATGCTTTAATGACGGGTATTCAAATTGGCG
AAGACGCAGCTCCGATCGGCCAGTTATCGCAAACCGCGAGAGCGGTCACCATTCCTGAGCCAAAGGCGAA
AGCCGAGGGCGCTTCCGAGCCGGAGCAAGGCACCGACAACGATTGGAATAACAGCGGTGGCGGAGGAAGC
GGCGACAGTAGTTGGTGA