SecReT6
Protein ID: 83646944
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04247
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4391108..4391641 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ2SEH0
KEGG IDhch:HCH_04247
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.10E-58, Aligned region: 9..165
Protein Sequence: 177 a.a.     [Download]
>gi|83646944|ref|YP_435379.1| hypothetical protein HCH_04247 [Hahella chejuensis KCTC 2396]
MSDSLQDKLNRVRKPRVHITYDVETGGAEVKKELPFVVGVMGDYSGDNTDAKKSLKERKFVNIDRDNFNE
IMEKVSPTLDLKVADEISGDPDKQVGMSLAFNSIEDFEPQNIVKQIPALKELLEARNRLRDLLSKADRSE
ELEGLLEQVLSDADKMAVLSKEVEERSPAKDEDGGDA
 
Nucleotide Sequence: 534 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4391108-4391641 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGTCAGATAGCCTACAGGATAAATTAAACAGAGTCCGTAAACCGAGAGTGCACATTACTTATGATGTGG
AAACCGGCGGTGCGGAAGTTAAAAAAGAGCTGCCATTTGTAGTTGGGGTCATGGGCGATTACTCAGGCGA
CAACACTGACGCCAAGAAATCCCTGAAAGAGCGCAAGTTCGTCAACATTGACCGTGACAACTTCAACGAA
ATCATGGAGAAAGTCTCTCCGACTCTGGACCTCAAAGTAGCAGACGAAATTTCCGGCGACCCTGACAAGC
AAGTAGGCATGAGTCTCGCCTTCAATTCCATTGAAGATTTCGAACCCCAGAATATCGTTAAACAAATTCC
GGCGCTGAAAGAGTTGCTGGAAGCGCGCAACCGCCTGCGCGACCTGCTGAGCAAGGCTGACCGCTCTGAG
GAGCTGGAAGGCCTGTTGGAGCAGGTTCTATCTGACGCAGACAAAATGGCGGTATTGAGCAAAGAAGTGG
AAGAGCGTAGCCCGGCCAAAGATGAAGACGGAGGAGATGCCTAA