SecReT6
Protein ID: 83646945
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04248
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4391641..4393134 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ2SEG9
KEGG IDhch:HCH_04248
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-186, Aligned region: 63..494
Protein Sequence: 497 a.a.     [Download]
>gi|83646945|ref|YP_435380.1| hypothetical protein HCH_04248 [Hahella chejuensis KCTC 2396]
MSDAELQGQESGAAEESSSSLLDMAITATKQTEPEQAQDLIANLAKQAGAGMVKWDRNLTVTINKAIDQI
DALMSKQLAAIMHEDKFQKLEGSWRGLHHLIMNSETSSSLKIRMLNIGKRELYKDLDKAVEFDQSQIFKK
IYESEFGTAGGEPYGALIGDFEFSNHPEDIELLQNMAGVSAAGFCPFISAAGPQMFGFDDFTELSTPRDL
EKIFETQEYIPWRSFRDSDDSRFVTLVMPRVLSRMPYGRNGKSIEDFNYEELPIDSKTGKAANVEHDKFA
WMNAAYVMGTTLTQAFAEHGWCVAIRGAENGGKVTGLPSHLFVSDDGDVDQKCPTEVGITERREAELSKQ
GFLPLLHYKNTDYAVFFGSQTCQKAKKFDKADATANAAISARLPYIMATSRVAHYLKVMARDKIGSFMDA
KGAERWLNNWINTYCNSNPDASPESKAKYPLAEARVEVKENPESPGSFSAVAHLRPWLQMEELTTSLRLV
AEIPKSG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4391641-4393134 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGAGCGACGCAGAATTACAAGGTCAGGAATCCGGAGCAGCGGAAGAGTCCAGTTCCAGTCTGCTGGATA
TGGCGATTACCGCCACCAAACAAACCGAGCCTGAACAAGCCCAGGACCTGATCGCAAACCTGGCGAAACA
AGCGGGCGCAGGTATGGTCAAATGGGACCGCAACCTCACCGTCACTATCAATAAAGCGATTGATCAGATT
GATGCGTTGATGTCCAAGCAATTGGCGGCCATCATGCACGAGGACAAATTCCAGAAGCTGGAAGGCTCCT
GGCGCGGCCTGCACCACCTGATCATGAATTCAGAGACCAGCTCCTCGCTGAAAATCCGCATGCTGAACAT
CGGCAAGCGCGAGCTGTACAAAGATCTGGACAAAGCTGTTGAATTTGACCAAAGCCAGATCTTCAAGAAG
ATCTACGAATCTGAATTCGGCACCGCAGGCGGCGAGCCTTACGGCGCGTTGATCGGCGACTTCGAGTTCT
CCAACCATCCGGAAGATATTGAGTTGCTGCAAAACATGGCTGGCGTTTCCGCCGCCGGTTTCTGCCCTTT
CATTTCCGCCGCAGGCCCACAGATGTTCGGCTTTGACGACTTCACCGAACTCTCCACGCCTCGCGATCTG
GAGAAAATATTTGAGACCCAGGAATACATCCCCTGGCGCAGCTTCCGGGATTCCGACGACTCCCGTTTCG
TCACCCTGGTTATGCCCCGCGTACTGTCTCGCATGCCTTATGGCAGAAACGGTAAGTCCATCGAAGACTT
CAACTACGAAGAGCTGCCGATCGACTCCAAGACTGGCAAAGCCGCTAACGTCGAGCACGACAAGTTTGCG
TGGATGAACGCGGCTTACGTCATGGGCACCACCCTGACCCAGGCTTTCGCTGAGCACGGCTGGTGTGTGG
CGATCCGCGGCGCGGAGAATGGCGGTAAAGTGACTGGCCTGCCTTCCCACTTGTTCGTCAGCGATGACGG
CGACGTTGACCAGAAGTGTCCGACAGAAGTGGGCATCACCGAGCGTCGTGAAGCGGAACTGTCCAAACAA
GGCTTCCTGCCTCTGTTGCACTACAAGAATACCGACTATGCCGTATTCTTCGGTTCACAGACCTGCCAGA
AGGCCAAGAAATTCGACAAAGCCGACGCGACCGCCAACGCAGCGATTTCCGCAAGACTGCCTTACATCAT
GGCTACCTCGCGCGTCGCTCACTACCTGAAGGTCATGGCTCGCGACAAAATCGGTTCCTTCATGGACGCC
AAAGGCGCAGAACGCTGGTTGAACAACTGGATCAACACCTACTGCAACAGCAACCCGGACGCATCGCCCG
AATCCAAGGCGAAGTATCCGTTGGCTGAAGCGCGCGTTGAGGTTAAAGAGAATCCAGAATCTCCTGGTTC
TTTCAGCGCCGTCGCTCACCTGCGCCCATGGTTGCAAATGGAAGAGCTCACCACTTCTTTACGTCTGGTT
GCGGAAATTCCTAAGTCTGGTTGA