SecReT6
Protein ID: 83646946
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04249
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4393264..4394772 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ2SEG8
KEGG IDhch:HCH_04249
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-152, Aligned region: 67..498
Protein Sequence: 502 a.a.     [Download]
>gi|83646946|ref|YP_435381.1| hypothetical protein HCH_04249 [Hahella chejuensis KCTC 2396]
MQNKVSPNDTPMPFTYGVAQKRTQGPSSAEVIALKKILQWIKLPDWCYEDKAAGKPLDYDYLILWLQRAV
AQIDNKIINQVNHILHHSKFQDLERAWRSLYDVVSYAYGRKLVKIRFLDITWSEITKDVNRSVEFDQSQL
FHKIYSEEYDVPGGEPYGIIVMNFEVAHKPFAGHRFNDIPTLERLAEIGAASFSPILLNAAPQLFEMNSF
PEITSPISLKQLFSEQDYIAWNSLRDHPDTRFLGLTIPRVLIRNPYSVQIAPHGGLLFSEKRAQASNENY
LWGYANFALVKVLIREFTEVGWFSHIRGLLRDHMAGGAVDNLVVDAFSTDAKKIAHKPIVDAVFSDERER
ALSEHGLIALCQCYDVPMGVFYSTPTLHRPKVFQDRIASANSRLSSLLQHVLCGSRFAHYIKVITRDMIG
SVRRAEDCERELQRWLTQYVTSQEDADWFMQARYPLREGSVQVREIPEKPGSFATTIYLRPHYQADRLVS
ELHLTTEVNTAS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4393264-4394772 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGCAGAATAAAGTATCTCCAAACGACACCCCCATGCCGTTTACCTACGGTGTTGCGCAGAAGCGCACGC
AGGGGCCGAGCTCCGCCGAAGTCATCGCGCTCAAGAAGATACTGCAATGGATCAAGCTTCCAGACTGGTG
TTACGAGGACAAAGCCGCTGGTAAGCCACTGGATTACGACTACTTGATTCTTTGGCTGCAAAGAGCCGTC
GCCCAGATCGACAACAAGATCATCAACCAGGTCAATCATATTCTTCATCACAGCAAGTTCCAGGATTTGG
AGCGCGCATGGCGCAGCCTGTATGACGTAGTGAGCTATGCATATGGCCGCAAACTGGTGAAGATCCGATT
TCTGGATATCACTTGGTCGGAAATCACCAAAGACGTGAACCGCTCAGTGGAATTCGACCAAAGTCAGTTA
TTCCATAAGATATACAGCGAAGAATACGACGTGCCCGGGGGCGAACCCTACGGCATCATCGTGATGAATT
TTGAGGTGGCCCATAAACCCTTTGCGGGACACCGTTTTAACGATATTCCAACCTTGGAGCGTCTGGCTGA
AATCGGCGCGGCCTCTTTCTCGCCGATACTTCTTAACGCGGCGCCCCAATTGTTTGAAATGAACAGTTTC
CCGGAAATCACCAGCCCGATCAGCCTGAAGCAACTCTTCAGCGAACAGGACTACATTGCCTGGAACAGTC
TACGCGATCACCCTGACACACGTTTCCTGGGTCTGACTATCCCCCGGGTGCTGATCCGCAATCCCTATTC
CGTTCAAATCGCCCCACACGGCGGGCTGCTTTTCTCAGAAAAGCGCGCTCAGGCCTCCAATGAAAATTAT
TTATGGGGATACGCCAACTTTGCGCTGGTCAAGGTATTGATACGCGAATTCACCGAGGTAGGTTGGTTTT
CGCATATTCGCGGCTTACTTCGCGACCACATGGCGGGTGGCGCTGTCGATAACCTAGTGGTGGATGCATT
CTCTACGGACGCCAAGAAGATCGCGCACAAGCCGATTGTTGACGCCGTCTTTTCCGACGAGCGCGAGCGT
GCGCTCAGTGAACATGGACTCATTGCGCTATGCCAATGCTACGATGTCCCCATGGGCGTGTTTTACAGCA
CCCCGACCCTGCACCGACCAAAAGTATTTCAGGACAGGATCGCCAGCGCCAACTCCAGGCTGTCTTCATT
GCTGCAACATGTTTTGTGCGGCTCCCGTTTCGCCCACTATATCAAGGTGATCACCCGCGATATGATCGGC
TCCGTCAGGCGGGCGGAAGACTGCGAGCGCGAACTGCAGCGCTGGCTGACTCAATACGTGACCTCGCAGG
AGGACGCGGACTGGTTCATGCAGGCGCGCTATCCGTTGCGTGAAGGCTCGGTGCAAGTCAGAGAGATTCC
TGAGAAGCCCGGCTCTTTCGCCACCACTATTTACTTGCGTCCGCACTATCAGGCCGATCGTCTGGTATCG
GAGCTACATTTGACGACAGAGGTTAACACCGCTAGTTAA