SecReT6
Protein ID: 83646947
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04250
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4394782..4395273 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ2SEG7
KEGG IDhch:HCH_04250
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-21, Aligned region: 38..143
Protein Sequence: 163 a.a.     [Download]
>gi|83646947|ref|YP_435382.1| hypothetical protein HCH_04250 [Hahella chejuensis KCTC 2396]
MTKISKSQKLRPSVLDRLIDERPDLKVEPEKNRHQVLNELRESVRRDLEDLLNTRYRPISASDNLRQLDE
SLINYGLPDLHTINFLSAEGKSQFCRTVEQHIAMFEPRFKSVRVITLDEDWAEGATLHFRIEAVLFAEPA
PEEISFDSSLEPISAIVNVQEAR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4394782-4395273 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGACGAAAATAAGTAAGAGCCAAAAACTGCGCCCTTCGGTGCTGGACCGGCTGATAGATGAAAGGCCGG
ACCTGAAAGTAGAACCGGAAAAAAATCGCCATCAGGTGCTCAACGAGCTCCGCGAATCCGTGCGCCGCGA
TCTTGAGGATCTCCTCAACACGCGTTATCGCCCTATCTCCGCATCCGACAACCTGCGTCAGTTGGACGAA
TCGCTGATCAATTACGGCCTGCCCGACCTGCACACCATCAACTTCCTTAGTGCGGAAGGTAAAAGTCAGT
TCTGCCGCACAGTGGAACAACATATAGCCATGTTTGAGCCCCGCTTTAAGTCGGTCAGGGTCATCACCCT
GGATGAGGACTGGGCGGAGGGCGCCACCTTGCATTTCCGCATTGAGGCGGTGTTGTTCGCCGAACCCGCT
CCCGAAGAAATCTCCTTTGATTCCTCGCTGGAGCCGATTTCGGCTATCGTCAACGTTCAGGAGGCGCGTT
AA