SecReT6
Protein ID: 83646948
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04251
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4395273..4397102 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ2SEG6
KEGG IDhch:HCH_04251
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.60E-213, Aligned region: 5..609
Protein Sequence: 609 a.a.     [Download]
>gi|83646948|ref|YP_435383.1| hypothetical protein HCH_04251 [Hahella chejuensis KCTC 2396]
MSDELLPYYEKELAYLRQSGAEFARVHPKIAGRLRISGDVVEDPHVSRLLEGVAYLNARIQYRLEDDFSE
LSDALLDQLYPHYLRPIPSMAVVQFRAAKDLDGPLHVARHSRLESDVFQNKVCRFSTGYDLDLLPVEVTK
ASLKERPFIAPGSQTVQGASAVIHVRLEGFAPEIDLGQLPLDKIRFFLRGQSQYAYSLYELLMNHCVQIV
ASKGADDVNPMFLHSSCLQPVGFAEEEALIPTPPQSFPGYRLLTEYMVFPEKFLFVDLTGLGERLNEKFG
PNLDLYFYLNKSHAELERNLEASNFALGCTPIINLFKHRAEPIDIEHDQYSYPVIPDARFPDNYEVYSID
RVQGLTGDGKKKEYKPFYGLSHFDIGRETQLFWHAQRYPKIGGELGNEPGSELEISLVDLNYAPANLSDE
TLTVDVMCFNRNTPEKLPFGGGQPRFTCLDVGVSLRGIDSLTHLTPTVRPPLRDGARWRLVSHLTLNYLS
LDSPEAIDVLKEILALYDFQDSAASRAIIAAVVNVQTRPMTAPITIGGKTTVCRGVEIEVTFDDNLMSGN
STFLFASILERFFAMYCSINAFTRLIARIKGRQDILKKWPPRIGSQPLI
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4395273-4397102 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGAGCGACGAATTATTACCCTATTATGAAAAGGAACTGGCTTACCTGCGCCAGTCCGGTGCGGAATTCG
CCCGCGTGCATCCCAAGATCGCCGGTCGTTTACGCATCTCCGGCGATGTGGTGGAAGACCCGCACGTTTC
ACGCCTGCTGGAAGGCGTGGCGTATTTGAACGCCCGTATTCAATATCGTTTGGAGGACGACTTCTCCGAA
CTCTCGGACGCCCTGCTCGATCAGCTCTACCCACACTATCTGCGACCAATCCCGTCTATGGCGGTGGTGC
AGTTCAGAGCAGCGAAAGATCTGGACGGTCCGTTACATGTCGCACGCCATTCGCGCCTGGAAAGCGACGT
TTTCCAGAATAAAGTGTGCCGTTTCAGCACCGGTTACGACCTGGATCTGCTGCCTGTCGAAGTCACCAAA
GCAAGCCTCAAGGAGCGCCCGTTTATCGCCCCCGGTTCGCAAACCGTGCAAGGCGCCTCTGCGGTAATTC
ACGTGCGCCTGGAGGGTTTCGCCCCGGAAATCGATTTGGGCCAGTTGCCGCTGGATAAAATCCGCTTTTT
CCTGCGTGGTCAGTCGCAATACGCTTATTCGCTTTATGAGCTGCTGATGAACCATTGTGTGCAGATTGTC
GCTTCCAAAGGCGCCGATGACGTCAATCCGATGTTCCTGCACAGCAGTTGCCTGCAGCCCGTCGGTTTCG
CCGAGGAAGAAGCGCTGATACCTACGCCGCCACAGTCTTTCCCGGGTTACCGACTGCTCACCGAGTACAT
GGTGTTCCCGGAAAAATTCCTGTTCGTTGACCTGACCGGTCTTGGCGAACGCTTGAATGAGAAGTTCGGC
CCCAATCTGGATTTGTATTTCTATCTCAACAAATCTCATGCGGAGCTGGAACGCAATCTGGAGGCCAGCA
ATTTCGCCCTGGGTTGCACGCCCATCATCAACCTGTTCAAGCATCGGGCGGAGCCCATAGATATTGAGCA
TGATCAATACAGCTACCCGGTCATTCCTGACGCGCGCTTCCCGGACAACTATGAAGTGTATTCCATTGAT
CGCGTACAGGGCCTGACCGGCGACGGCAAGAAAAAGGAATACAAACCCTTTTATGGCTTAAGCCACTTCG
ATATCGGCCGTGAGACCCAGCTTTTCTGGCATGCTCAACGCTATCCGAAAATCGGCGGCGAGCTAGGCAA
CGAGCCCGGCAGCGAGCTGGAAATTTCCCTGGTGGACCTGAATTACGCGCCGGCGAATTTGTCCGACGAG
ACCCTGACTGTCGATGTAATGTGCTTCAACCGCAATACGCCGGAAAAGCTGCCTTTTGGCGGCGGACAGC
CTCGCTTCACCTGTCTGGACGTTGGCGTTTCCTTGCGCGGCATCGACTCTTTGACACACCTGACGCCAAC
TGTACGACCGCCGTTGCGGGACGGCGCGCGCTGGCGCCTTGTGTCGCATCTGACCTTAAACTATTTATCC
CTTGATAGTCCGGAAGCCATTGACGTACTTAAGGAAATTTTGGCGCTATATGATTTTCAGGACAGCGCGG
CCTCACGGGCGATCATCGCCGCCGTGGTCAATGTGCAGACCCGGCCGATGACGGCGCCGATCACTATTGG
CGGCAAAACCACCGTGTGCCGTGGGGTGGAAATCGAAGTCACCTTTGACGACAACCTGATGTCGGGCAAC
AGCACCTTCCTGTTCGCCTCGATTCTGGAAAGGTTCTTCGCCATGTATTGTTCGATTAACGCGTTCACCC
GATTAATTGCCCGTATCAAAGGGCGACAGGATATTCTCAAGAAATGGCCACCGAGAATCGGCTCCCAGCC
TCTCATTTAG