SecReT6
Protein ID: 83646949
SecReT6 ID109
T6SS typei5
Gene symbol-
Locus tagHCH_04252
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4397066..4398187 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ2SEG5
KEGG IDhch:HCH_04252
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-85, Aligned region: 18..340
Protein Sequence: 373 a.a.     [Download]
>gi|83646949|ref|YP_435384.1| hypothetical protein HCH_04252 [Hahella chejuensis KCTC 2396]
MATENRLPASHLAKRLQQDPWRFDFFQLVRLLEHFDPQDARPRTPLGGFYPPRNEPVRFVVNPSMGFEGG
AVDKITRGGDKSLASRDQWSMAVNFWGLVGSRGVLPFHYRDLILQRLRQKDKSMKHFFDLLDHRTLSLFY
RSWKKYRIPLTFEANHQLDPKYNRDRHAEMIKGLMGLASMRSAKFYQPSGDIFNVAGLMSRGVCSAEALS
QAIRQHFGLKVSILHFRGQWRRMPDDVQTRLGGSRFPGVNHCLGQQAILGEKTWSVQNRFTVHFDDIDYP
RFLSIVSGTEILGAMYKLIRTMAGVALDFDLSLKVRQDRLPNSQLAHPTAPPLLGWNSKLFSTRQQDRFI
TVSVSRHAMQRTIERLQKKRETL
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4397066-4398187 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGGCCACCGAGAATCGGCTCCCAGCCTCTCATTTAGCCAAACGGCTGCAGCAGGACCCCTGGCGGTTCG
ATTTTTTCCAGCTGGTGCGCCTGCTGGAGCATTTCGACCCGCAGGATGCGCGACCTCGCACTCCCCTGGG
TGGATTTTACCCGCCCAGGAATGAGCCTGTACGCTTCGTCGTGAATCCCAGCATGGGCTTCGAGGGCGGC
GCCGTAGACAAGATTACCCGCGGCGGGGACAAGTCGCTGGCGTCTCGTGATCAGTGGTCAATGGCGGTGA
ACTTCTGGGGACTGGTCGGCTCGCGCGGCGTACTGCCGTTCCATTACCGCGACCTGATTTTGCAGCGTCT
GCGACAGAAAGATAAGTCGATGAAGCACTTCTTCGACTTATTGGACCACCGCACGTTATCGCTGTTTTAT
CGCTCCTGGAAAAAATATCGCATTCCGCTGACTTTCGAGGCCAATCATCAGCTTGACCCCAAATACAACC
GTGACCGACATGCGGAGATGATCAAAGGGTTGATGGGTTTGGCCAGCATGCGCAGCGCCAAGTTCTACCA
ACCTTCCGGCGACATCTTCAACGTCGCGGGTTTGATGAGTCGCGGCGTGTGTTCCGCTGAGGCGTTGTCG
CAAGCCATTCGCCAACATTTCGGTCTGAAGGTGAGCATCCTGCACTTCCGCGGTCAATGGCGGCGCATGC
CGGACGACGTGCAGACCCGTCTGGGCGGCAGCCGCTTCCCCGGCGTGAATCACTGCCTGGGACAACAAGC
CATTCTGGGTGAGAAGACCTGGTCGGTGCAGAACCGTTTCACCGTCCACTTCGACGACATTGACTACCCA
CGTTTCCTGTCTATCGTTTCCGGCACGGAAATCCTGGGGGCCATGTATAAGCTGATTCGAACTATGGCGG
GGGTTGCTCTAGACTTTGACTTATCGCTTAAAGTCAGACAGGACCGACTGCCAAACAGCCAGCTTGCGCA
CCCGACGGCGCCGCCTTTGCTGGGCTGGAACTCAAAACTGTTTTCAACACGACAACAAGATCGGTTCATT
ACCGTGTCTGTATCCCGGCACGCAATGCAGCGAACTATAGAAAGACTACAAAAGAAAAGGGAAACCTTAT
GA