SecReT6
Protein ID: 83716132
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0126
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]145209..146510 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ2T921
KEGG IDbte:BTH_II0126
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-62, Aligned region: 62..268
OmpA [PF00691], Evalue: 3.00E-17, Aligned region: 17..35
OmpA [PF00691], Evalue: 3.00E-17, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|83716132|ref|YP_438328.1| unnamed protein product [Burkholderia thailandensis E264]
MNSGAFDEAAFDFLASDEGRASVAADRARSAAKAAGAEPARAEIDASVNVQHRLDEVRAAANPLLEAANP
LLRMLADMPAMLDTSEAVSSLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSPHWRGAEPGKLPLLRSVPAWATGSFVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKDEPASPQQRLRLSILLKNEIARGLLTVDEDDARSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADHIRSEGRGDAQPVAENTTPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|83716035|ref|NC_007650.1|:145209-146510 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAACTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTCCTTGCGTCGGACGAAGGCCGGGCGAGCGTCG
CCGCGGATCGCGCGCGATCCGCGGCGAAGGCCGCGGGCGCGGAGCCCGCGCGCGCCGAAATCGACGCATC
GGTCAACGTCCAGCATCGCCTCGACGAAGTTCGCGCGGCTGCGAATCCGCTCCTCGAAGCAGCGAATCCC
TTGCTGCGGATGCTGGCGGACATGCCTGCGATGCTCGACACGTCCGAAGCCGTGTCGAGCCTTCGCACGC
TGCTCGTGCGCGAGGTCGCGCTGTTCCAGAACTTGTGCGAAAAGGCAGACCTGCCCTGGAAGCACATGGC
GGTCGTGCGTTATTGCCTGTGCACGGCACTGGACGAGGCGGCCAATCGCACGCGTTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACCTACGAAGGCGAAGTCGACGGCGGCGAGAAGTTCTTCCTGT
TGATCGGACGCATGGCGACGGACCCGCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGACGCTACAGCGTCGTGGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
CTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAGTTGTCGCCGCATTGGCGCGGAGCCG
AGCCCGGCAAGCTTCCGCTGTTGCGCAGCGTGCCCGCATGGGCGACAGGTTCGTTCGTCTTTCTGTTGCT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGCTGCTTACCGAACGCAACGCGCTCGAGGCCCGCATTCTG
GCCATCGCGAAGGATGAGCCGGCTTCGCCGCAGCAGCGTTTGCGCCTGTCGATATTGCTCAAGAACGAGA
TTGCGCGCGGTCTGTTGACGGTCGACGAAGACGACGCGCGCAGCGTCGTGGTCTTCCGCGGCGATTCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTTCTCGACAAGGTGGCCCGGGAAGTT
GCCCGTGTCGGCGGCAGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGATATCC
CGAACAACCTCGTGCTGTCGGAGAAACGCGCGGCTTACGTTGCGCAAATCCTGGTCCAGCGAGGCACACC
GGCCGATCACATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAGAACACGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTTGAAATCGCGGTCACGCTGTAA