SecReT6
Protein ID: 83716153
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0122
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]141005..142504 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ2T925
KEGG IDbte:BTH_II0122
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|83716153|ref|YP_438324.1| unnamed protein product [Burkholderia thailandensis E264]
MAARESQARSADAQLATQSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQKLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNVNRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|83716035|ref|NC_007650.1|:141005-142504 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGACGCACAGCTCGCTACGCAATCGGACTTCAACGCAC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACACGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCGGTGACGTTGTCGGACGACGCATACAAGAGCATCGAAGCGATCATC
GGCGAGATCGATCGAAAGCTGTCCGAGCAGATCAATCTGATTCTGCATCACGACGATTTCCAGAAACTGG
AAAGCGCGTGGCGCGGCCTGCATCACCTGGTGACGAATACCGAGACGGACGAGAAGCTGAAGATCCGCTT
CATGGACGTCTCCAAGGACGATCTGCGTCGTACGATGAAGCGATACAAGGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGGTGCCTCGTGG
CCGATTACTACTTCGATCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCCGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCGTCGGTACTCCAGATGGATTCGTGGCAGGAGTTGGCC
AATCCGCGCGACCTCACGAAGATCTTCACGCAGAACCTCGAATATGCGCCGTGGAATTCGCTGCGCAATT
CCGAAGACGCACGTTACATCGGTCTCGCGATGCCGCGTTTCCTTGCGCGCTTGCCGTATGGGATCAGAAC
GAACCCCGTCGACGAATTCGATTTCGAGGAATCGACGGACGGTTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCAATGGCGGTCAACGTTAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATCC
GCGGCGTCGAAAGCGGCGGCGTCGTCGAGAACCTGCCGTGCCACACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATCTCGGATCGCCGCGAGGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATTCATCGAAAGAACACCGACTACGCCGCGTTCATCGGCGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGATGCGACCGCGAATGCGAACTTGTCCGCCCGCCTGCCGTACCTGTTCGCATG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGTCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA