SecReT6
Protein ID: 83716378
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0873
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1024090..1025886 [+]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ2T6X9
KEGG IDbte:BTH_II0873
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-16, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 4.90E-16, Aligned region: 285..299
ImpA-rel_N [PF06812], Evalue: 4.90E-16, Aligned region: 558..568
Collagen [PF01391], Evalue: 0.00014, Aligned region: 205..239
Protein Sequence: 598 a.a.     [Download]
>gi|83716378|ref|YP_439070.1| unnamed protein product [Burkholderia thailandensis E264]
MGMNERRQPGGAASGALLPEDFDALGALGRADIDPAAPAGADVRADARFDALHAELAKLASPGASGHVDW
RAAMSLAAGLLRDRGKDLLVGCYLAGALLQIGGAAGLRCGLEVVGDLVERHWAAMSPPVSRMRARRGALQ
WLLDRVDATRDAGAAACGAACSVELVEQLRAAARRIDALLAERDDEAPTMRAVTAFAARLPVESGESGEP
GEPGEPGEPGEPGEPGESNSTHAHGSVGAPAERAALSFAEHASIEPAGRAAPRANADAARHPASLDDAAG
RERALADALAQLHRIATAFAQADWADTRGFRLRRIACWSSVHAMPDTEADSGRTRIAAPNAQVVDVAKGI
DAQGDPAAAVRFAEEHAQAFPLWLDLQRIAARALARAGGDCTGAQREVETAVRALLMRLPGLDALKFADG
TPFADAATRAWLAELCTPIGAANAALTSPPPPSPPAPSLPMTGESDRARGDARDANADDAHARARALAAS
GRLDLALGAIQQAIDRAPSAERRLRARIRLCEFARDHWEHEIPDAFARGVIEPIRRHDLLAWEPELALDG
LSAAYALLIRRDGDSAHARAVLNEIAGVDAARAMRLST
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|83716035|ref|NC_007650.1|:1024090-1025886 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGGAATGAACGAACGGCGTCAGCCCGGCGGCGCGGCCTCGGGTGCGCTTCTTCCCGAGGATTTCGACG
CGCTCGGGGCGCTGGGGCGCGCGGACATCGATCCGGCCGCGCCCGCGGGCGCCGACGTGCGCGCCGATGC
GCGGTTCGATGCGCTGCACGCGGAACTCGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCACGTCGACTGG
CGCGCGGCGATGAGCCTCGCCGCCGGGTTGCTCCGCGATCGCGGCAAGGATCTGCTCGTCGGCTGCTATC
TGGCGGGCGCGCTGCTGCAGATCGGCGGCGCGGCGGGATTGCGCTGCGGGCTCGAAGTCGTCGGCGATCT
CGTCGAACGTCATTGGGCGGCGATGTCGCCGCCGGTGTCGCGGATGCGGGCGCGGCGCGGCGCGCTGCAA
TGGCTGCTCGATCGCGTCGACGCGACGCGCGACGCCGGCGCCGCCGCGTGCGGTGCCGCCTGTTCGGTCG
AACTGGTCGAGCAATTGCGCGCGGCCGCGCGGCGCATCGACGCGCTGCTGGCGGAGCGCGACGACGAGGC
GCCGACGATGCGCGCGGTGACCGCGTTCGCGGCCCGGCTGCCGGTCGAGTCGGGCGAGTCGGGCGAGCCG
GGCGAGCCGGGCGAGCCGGGTGAGCCGGGTGAGCCGGGTGAGCCGGGTGAGTCGAATTCGACGCACGCCC
ACGGCTCGGTGGGCGCGCCTGCCGAGCGCGCCGCGCTTTCCTTCGCCGAGCATGCATCGATCGAGCCGGC
CGGCCGCGCGGCGCCGCGCGCGAACGCCGACGCCGCCCGGCACCCGGCGTCGCTCGACGACGCGGCCGGC
CGCGAGCGCGCGCTCGCCGATGCGCTCGCGCAACTGCATCGCATCGCGACGGCGTTCGCGCAAGCGGACT
GGGCCGACACGCGCGGCTTCCGGCTGCGCCGCATCGCGTGCTGGTCGAGCGTGCACGCGATGCCGGATAC
CGAAGCGGACAGCGGACGGACGCGGATCGCCGCGCCGAATGCGCAGGTTGTAGACGTCGCAAAGGGTATC
GATGCGCAGGGCGACCCCGCGGCTGCCGTCCGCTTCGCGGAGGAGCACGCGCAGGCGTTCCCGCTCTGGC
TGGATTTGCAGCGGATCGCCGCGCGCGCGCTCGCACGCGCGGGCGGCGATTGCACCGGGGCGCAACGCGA
AGTGGAGACGGCGGTGCGTGCGCTGCTCATGCGCTTGCCGGGCCTCGACGCACTGAAATTCGCGGACGGC
ACGCCGTTCGCCGACGCCGCGACGCGCGCGTGGCTCGCGGAGCTATGCACGCCGATCGGTGCGGCAAATG
CCGCGTTGACATCGCCGCCGCCGCCTTCGCCGCCGGCGCCGTCCTTGCCGATGACGGGCGAGTCGGATCG
TGCGCGGGGCGATGCGCGCGACGCGAATGCGGACGACGCGCACGCCCGTGCGCGCGCGCTTGCCGCAAGC
GGTCGGCTCGATCTCGCGCTGGGTGCGATTCAGCAGGCGATCGATCGCGCGCCGAGCGCCGAACGCCGGT
TGAGGGCGCGCATCCGGCTGTGCGAGTTCGCTCGCGATCACTGGGAACACGAGATTCCCGACGCGTTCGC
GCGCGGCGTGATCGAGCCGATCCGGCGGCACGACTTGCTCGCATGGGAGCCCGAACTGGCGCTTGACGGC
TTGTCGGCCGCCTATGCGCTGCTGATTCGGCGTGATGGTGATTCGGCGCACGCACGGGCTGTGCTTAACG
AGATCGCGGGCGTCGACGCGGCGCGGGCGATGCGTTTGTCGACGTGA