SecReT6
Protein ID: 83716389
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1893
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2293904..2296192 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ2T412
KEGG IDbte:BTH_II1893
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.10E-71, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 2.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|83716389|ref|YP_440087.1| unnamed protein product [Burkholderia thailandensis E264]
MRLIELRSPLLDPDVVALSFVVHENLSQEPSYQLDLLSRDPNLDFDELLGSTLSADIDLGGGDIRTFNTH
VFGGHDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNETLEYLPDGEESRAIQGREGV
QRLQRTRRIKASNVALRDFDYHAPSKQLDSDAQIEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDR
PYRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVNGTSTSVIGIKVSFTGISVSYTGLSVSFTGVSASFT
GVSTSFTGVSTSFTGVSTSFTGVTTGFTGVSTSFVGVDTSFTGISTGFVGVSTSITGSKNSVTGVSNSMT
GISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVGTTGSSMSATGSSVSTTGSSVSTTGSSMSVTGFSFSYIGASYSDVGIDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2296192-2293904 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCGTCTGATCGAACTACGCAGTCCGCTCCTGGACCCGGACGTCGTTGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAACCGTCGTATCAGCTCGACTTGCTGAGCCGCGATCCGAATCTGGACTTCGACGA
ACTGCTCGGCTCGACGCTGTCGGCCGACATCGATCTGGGCGGCGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCCACGACACGGGGCAGATGAGCGGGCAGTACACGTACACGCTGGAGCTGCGGAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGGACTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAACTGGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGGTTGCTGGAGGACGAAGGGATCTATTTCT
GGGTCGAGCACGAGCCGGATCGGCATGTCGTGGTGATTTCGGACACGCAGCGCTTCGAGGATCTGCCGCT
GCCGAACGAAACGCTCGAGTATTTGCCGGACGGTGAGGAATCGCGGGCGATCCAGGGGCGCGAAGGCGTG
CAGCGGCTGCAGCGCACGCGCCGGATCAAGGCGAGCAACGTCGCGCTGCGCGACTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGATCGAGCAGCAGAGTCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGATCCCGAGCAAGGCGAGCGCCTGGCGCGGCTGCGGCTTGAAGCGATT
CAGGCCGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTCGCGGTGGGTCGCGCGTTCACGC
TGGTTGGGCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATTCA
GGACGGGCCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCGG
CCGTATCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGGC
CAGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGCATCCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAAGCGGACGCCTCGTGCTGGATTCGCGTGACGCAGGCGTGGGCCGGCAAGGGCTGGGGTGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTGATCGTCGTGTATGTCGACGGCGATCTCGATCGCCCGCTTG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTACGACCTGCCGAAGGACATCCGCTACACGGG
CCTCGTCACGCGCTCGATCAAGCGCGCGGGCGGCATTCCGAATGCGAGCCAGTTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCCA
CGTCGATCGCGCAGGACCTGAATCTGTCGGTGAACGGTACGTCGACGTCGGTCATCGGCATCAAGGTCAG
CTTCACCGGGATCTCGGTGTCGTACACAGGGCTGTCGGTGAGCTTCACGGGCGTATCGGCGAGCTTCACC
GGCGTGAGCACATCGTTTACCGGCGTGAGCACGAGCTTCACCGGCGTGTCGACGTCGTTTACCGGCGTGA
CCACGGGCTTCACCGGCGTGTCGACTTCGTTCGTCGGCGTCGATACGAGCTTCACCGGCATCAGCACGGG
ATTCGTCGGTGTGTCAACCAGCATCACGGGCTCCAAGAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCGTCGTGGACCGACGTCAGCATGTCGACGACCGGGCAGTCGCAGAGCATCACGGGCGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACGTCGACGAG
CATCACGGGCACGTCGATGTCGAACACGGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACGACG
GGCAGCTCGGTGGGCACGACGGGATCGAGCATGTCGGCCACCGGCAGCTCGGTGAGCACGACGGGTTCGA
GCGTATCGACGACGGGCAGCAGCATGTCGGTGACGGGATTCAGCTTCTCGTACATCGGCGCGAGCTACTC
GGACGTGGGCATTGATCTGAAGAAGCTCGGGATGCAGACGAAGAACTGA