SecReT6
Protein ID: 83716407
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1897
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2302475..2304337 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ2T408
KEGG IDbte:BTH_II1897
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-128, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|83716407|ref|YP_440091.1| unnamed protein product [Burkholderia thailandensis E264]
MNFLDHYNDELRQLRDAGARFAKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYMASTPAISTFAFHPDLGSPDAFRGNTLPRGSLVAAHLPGRKLPVMFSTARDVTLLPLRL
ASVECSRSITGLPSLLSQRLASSHAVLRFRFEVEGGASIAELAREDEGFKPLHLSLAGDLPRAYALHRAM
LADTTAWYALVSTNRGDEVLTLPMSGIRLSGVDDAEALLPEEFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFELFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLDPDDVATITGRALVADRDWRPTGLLDADLQLLDPTAVKRIECLWPASAPRGKPSVDACWEAV
SHVGRNPLALHASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVLLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVAARDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2304337-2302475 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAATTTCCTCGATCACTACAACGACGAATTGCGCCAGCTGCGCGATGCCGGCGCGCGCTTTGCGAAAG
AGCACCCGCAGGTCGCGTCGGCGCTCGGGCTGCATCCCGATGCGGTCACCGATCCGTTCGTCGAGCGGTT
GCTCGAGGGCGTCGCGTATCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCCGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACATGGCGTCGACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCGGATCTCGGCTCGCCCGACGCGTTTCGCGGCAATACGCTGCCGCGCGGCTCGCTCGTCGCCGCGCA
TCTGCCGGGCCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGACGTCACGCTGCTGCCGCTGCGTCTG
GCGTCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCTCGCAGCGGCTGGCATCGTCGC
ATGCGGTGCTGCGCTTCAGGTTCGAGGTCGAAGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
GGGTTTCAAGCCGCTGCATCTGAGTCTCGCGGGCGATCTGCCGCGCGCCTATGCGCTGCATCGCGCGATG
CTCGCCGATACGACCGCGTGGTATGCGCTCGTGTCGACCAATCGCGGCGACGAGGTGCTGACGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGATGCGGAGGCGCTGCTGCCGGAGGAGTTCGGCGGCTTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCGACGCGTCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCCAAGGCGCCGTCGGCGCGGGCGTTCGAGCTGTTCTTCGCATTACGCGACGCACCGG
GCGATCTGGTCGGCGACGTTGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGATCCGGTGCCCTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTGACCGAGGTGTTCGTGTGCGAGACCAACGGTCGAGCGCATCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTATGAGGGCCACGAGGGCTCGATCCGCTACGGCATGCGGCGCGA
GGATGCGCTGCTCGTCGACGGCGTGCGGCGTGATCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGACCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGTCCGACCGGGCTGCTCGACGCCGACCTGCAACTGCTCGATCCGACCGCCGTCAAGCG
TATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCGTCGACGCGTGCTGGGAAGCCGTG
TCGCACGTCGGCCGCAATCCGCTCGCGCTGCACGCGTCGCAACAGCAGGACGTGACGGCGCGCATCGTCG
AGCAACTGCTGCTCGCGATCGACAAGGACGATGCGCTCGACCGGCAACGGCTCGAGAGCCTGCGCTCGGT
CCTGCTGCGCTCGCGCTTCGTCGCGGCGGGCCGGGCGACGCCCACCGCGCTCGTGCGCGCGACGCAAGTC
GAGATCGATATCGCCGAATCGCTGCATGCGGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCCGAGGCCGCGACGCTCAATGACGGCATCGAGATCGTCGTGCGCCTCGACGGCGAGGCGGCGAG
CACGCACACGAACGTCGCGGCGCGCGACGGGAGGCTCGCATGA