SecReT6
Protein ID: 83716495
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1887
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2287509..2288870 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ2T418
KEGG IDbte:BTH_II1887
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|83716495|ref|YP_440081.1| unnamed protein product [Burkholderia thailandensis E264]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQAALRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDVACLALQAARTGGPEMAFGDVASASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLITRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2288870-2287509 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCGCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGATCAGGACGGCCTCGGGCTCGGCAGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCCGACGATCCGCTGCCGCCGCCGCTCGAGACCGAGCTCG
CGCAGGCGGGCGACGTCGCGTGCCTCGCGCTGCAGGCCGCGCGCACGGGCGGGCCCGAGATGGCGTTCGG
CGACGTCGCGTCCGCGTCGCGCTATCGCGCGGTGTCGACCGAAGTGCCCGATCTCGCGGTCGGCCTCGAC
GCGCCCGGCACGCCGCGGCGTCTGACGATCGAGACGGGCCAGCTCATCACGCGCCTTTGCTGGAAGTCGC
AGTTGCGCTCCGACGAAGTCGCGCTGCCGATCGCGCGCGTCGCGGGCCGCAACGCGAGCCGCACCGTGTC
GCTCGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTCGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAACGCGTGCTGTCGACGGGCGGCG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCCTCGCGAACCT
CGACGCGTTCGACCCGCTGCCGCCCGCGATGCTGTATCACGAGCTCGTCGGCCTGCTCGGGCGCCTGAGC
GTGCTGCCGGGCGTGGACGAGGAACTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACGCCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTCGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGCTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGCCTGAACGCGCTGCCCAA
TCCCCCACGCCAGATTCCCTACTACGCCCAAAGTACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCGGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA