SecReT6
Protein ID: 83716514
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0121
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]140432..140971 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ2T926
KEGG IDbte:BTH_II0121
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.20E-61, Aligned region: 11..164
Protein Sequence: 179 a.a.     [Download]
>gi|83716514|ref|YP_438323.1| unnamed protein product [Burkholderia thailandensis E264]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPIEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPAAQQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|83716035|ref|NC_007650.1|:140432-140971 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTCCAGATCGAATACG
ACGTCGAGATTTACGGTTCCGAAAAGAAAGTCGAGCTTCCTTTCGTGATGGGCGTGCTTGCGGACCTGTC
GGGCAAGCCGATCGAGCCTTTGCCGGCTGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCAATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAACACCCTTTCCGGCGACGGTC
AGTTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCCCCCGCGGCGATCGCGAAGAAGGTGGA
CGCGTTGTCGCAATTGCTGGACGCACGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGTGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGACCCCGCGCTGCTCAGCGCGCTCGCGAAGGCGCCGA
AGCCTGCGGCGCAACAGGCGGAAAACCGGGAATCGAAGGAAAAGCACTGA