SecReT6
Protein ID: 83716566
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0138
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]164590..165444 [-]
ProductImpE protein superfamily protein
NoteTagJ
UniProt IDQ2T909
KEGG IDbte:BTH_II0138
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.40E-44, Aligned region: 155..275
Protein Sequence: 284 a.a.     [Download]
>gi|83716566|ref|YP_438340.1| unnamed protein product [Burkholderia thailandensis E264]
MTNRSESTHNSDLHDEMLHDALRTQSFEEIKARTAEAVRKKPSDTRERWLLFQLLCIDGAWDRALKQLQT
WAQLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLEANAKLGAGDVAAADALRESA
FDSAPVTCGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALM
LDATVLRGYAPTRYPGSENGTTAIRLASETTWSDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESD
DAAS
 
Nucleotide Sequence: 855 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c165444-164590 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACGAATCGATCTGAATCTACGCACAACTCCGATCTGCATGACGAAATGCTGCACGACGCGCTGCGCA
CCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAAGCGGTCCGCAAGAAGCCATCCGACACGCGGGA
ACGCTGGCTATTGTTTCAATTGCTTTGCATCGACGGCGCATGGGACCGCGCGCTCAAGCAACTGCAGACC
TGGGCGCAACTCGAGCCGCAGGGCGAGGCGCGTGCGCAACTGCATCGCGGCCTGATCCGATGCGAAATGT
TCCGGGCCGACGTGTTTGCGGGCAAGCGAACGCCGGGATTCATCGACGCGCAGCCCGCTTGGGTCGATAC
GCTCCTCGAAGCGAATGCGAAGCTCGGCGCGGGCGACGTCGCAGCCGCCGATGCGCTGCGCGAGTCCGCG
TTCGATTCCGCGCCCGTCACCTGCGGGGAAAGCGCCGAAATGGGCAGCTTCGCATGGCTCACCGACAGCG
ACACGCGTCTCGGTCCGATATTCGAAATAGCGGTTGCGGGCGGCTATCGGTGGATTCCGTTCGAACAGCT
GAAGTCGATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTGGCGTCCGGTCACGGCGCTCATG
CTCGATGCCACGGTTCTCCGCGGCTATGCGCCGACCCGCTATCCGGGATCGGAAAACGGCACGACCGCAA
TCCGTCTGGCGAGCGAGACGACGTGGAGTGACATCGGCACCACCAACGTCGTCGCTCTCGGGCAACGAAC
GTGGACCACCGACCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATGCCGCTTCACGGGCGAAAGCGAC
GATGCGGCATCCTGA