SecReT6
Protein ID: 83716626
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0866
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1016371..1018113 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ2T6Y6
KEGG IDbte:BTH_II0866
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-154, Aligned region: 6..580
Protein Sequence: 580 a.a.     [Download]
>gi|83716626|ref|YP_439063.1| unnamed protein product [Burkholderia thailandensis E264]
MATTTLNRYYEDELVRLRELAAEFGRAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDDGLPELV
QALANLLFPHSLCPVPAATLIAFEPRGALRERAVVAAGTEIESMPVDGTACRFRTCGDLDVEPIALAGCR
FVPPADGGPALRLDFEMLGIDASEWDATRIRLFVGGERLHASRLFAFLMQHVVSVDIASGPPELPGPRCT
LGGRALRAAGFDDALLPCPERAFPGFRLLHEYFAYAEKFLFVELSGIERWRTARSGSQFSVRLALDCAPD
WLPGIERDSFRLNVVAALNLFAHEAVPIQHEHRATDYRLQPEGDAHGHCRIYSVDRVVGYRPGHPVDRHY
VAFGAAGDGALTASYRLIRRAALDGRGHDVHLALAYPPGEALAAETLSIGLSCTNGTLPARLRIGDVCRP
TDSSPERFAFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGNVDNLKQMLALHAFGERGDAARAQAD
RRRIDGIEAVDVRAETRIVGERMLSGQHVALRCRAHAFGGAGELYLFGCVLERFLAEYAALNTYTRVEID
ASPDDGRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1018113-1016371 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCCACCACCACGCTGAATCGCTATTACGAGGACGAACTCGTCCGCCTGCGCGAGCTCGCCGCCGAGT
TCGGCCGCGCGCACCCGCTGCTCGCGCCCATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAGAAGCTCGACGACGGCCTGCCGGAACTCGTG
CAGGCCCTCGCGAACCTACTGTTTCCGCACTCGCTGTGCCCGGTTCCGGCGGCGACGCTGATCGCGTTCG
AGCCGCGCGGCGCGTTGCGCGAGCGCGCGGTGGTGGCGGCCGGCACCGAGATCGAATCGATGCCTGTCGA
CGGCACGGCCTGCCGGTTCCGCACGTGCGGCGACCTCGACGTCGAGCCGATCGCGCTCGCCGGCTGCCGT
TTCGTGCCGCCGGCGGACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGCATCGACGCGAGCG
AATGGGATGCGACGCGCATCCGCCTGTTCGTCGGCGGCGAGCGGCTGCACGCGAGCCGGCTGTTCGCGTT
CCTGATGCAGCACGTCGTATCGGTCGACATCGCGAGCGGCCCGCCGGAGCTGCCCGGCCCCCGCTGCACG
CTCGGCGGCCGCGCGCTGCGCGCGGCGGGCTTCGACGACGCGCTGCTGCCCTGCCCCGAGCGCGCGTTCC
CCGGCTTCAGGCTGCTGCACGAATATTTCGCATACGCCGAGAAATTCCTGTTCGTCGAGCTGAGCGGCAT
CGAGCGCTGGCGCACCGCGCGCTCGGGCTCGCAGTTCAGCGTGCGGCTCGCGCTCGATTGCGCGCCCGAC
TGGCTGCCCGGCATCGAGCGCGACAGCTTCCGGCTGAACGTCGTCGCCGCGCTGAACCTGTTCGCGCACG
AGGCGGTGCCGATCCAGCACGAGCACCGCGCGACCGACTACCGGCTGCAACCCGAAGGCGACGCGCACGG
CCACTGCCGGATCTACTCGGTCGATCGCGTGGTCGGCTATCGCCCCGGCCATCCGGTCGATCGGCATTAC
GTCGCGTTCGGCGCGGCGGGCGACGGCGCGCTCACCGCGAGCTACCGGCTGATTCGCCGCGCGGCGCTCG
ACGGACGCGGGCACGACGTCCATCTGGCGCTCGCGTATCCGCCCGGCGAGGCGCTCGCGGCGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCACGTTGCCCGCGCGCCTGAGGATCGGCGACGTGTGCCGCCCG
ACCGACAGCTCGCCCGAGCGCTTCGCGTTCGCGAACATCGCGCCCGTGAGCCCGCCGCTCGACCCGCCGC
TCGGCGAGCCGCTGCTGTGGCGAACCATCGGCCATCTCGCGCTGAATTTCCTGTCGCTCGGCAACGTCGA
CAACCTGAAGCAGATGCTCGCGCTGCATGCGTTCGGCGAGCGCGGCGACGCTGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAAGCGGTCGACGTGCGCGCCGAGACGCGGATCGTCGGCGAGCGGATGC
TGAGCGGCCAGCACGTCGCGCTGCGCTGCCGCGCTCACGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTCCTGGCCGAATACGCGGCGCTCAACACGTACACGCGAGTCGAGATCGAC
GCGTCGCCTGATGACGGGCGCTTCGCATGGCCGCCGCGGATGGGGGCGCAATGCCTGCTCTAG