SecReT6
Protein ID: 83716722
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0856
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1001572..1002252 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ2T6Z6
KEGG IDbte:BTH_II0856
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-41, Aligned region: 2..212
Protein Sequence: 226 a.a.     [Download]
>gi|83716722|ref|YP_439053.1| unnamed protein product [Burkholderia thailandensis E264]
MMKLSDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDQAACAGAPEADVDDALFAVCAWIDEALL
NSGWNDAERWTLRLLQKRYFDTSHAGVVFFERLDALDGARADVLDVYLLCLQLGFRGRYGYDGGSGPLDA
IRQRALDALSAHAPPCAAHALPFPAAYPHAETQPGAHAIAAKARARRRIALAGRNFGLPLAILLSLYLIY
HAVIVRMVDSVFPRLQ
 
Nucleotide Sequence: 681 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1002252-1001572 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGATGAAGCTGTCCGATTCGATGATGCCGCTCGTCGCCTATGCGCGGCAGCTCGCGCAATCGCCGCGCG
GCGACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCAGGCGGCGTGCGC
CGGCGCGCCCGAAGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTG
AACAGCGGCTGGAACGACGCCGAGCGCTGGACGCTGAGGCTGCTGCAAAAGCGTTACTTCGATACATCGC
ACGCGGGCGTCGTGTTCTTCGAGCGCCTCGACGCGCTCGACGGCGCGCGCGCGGACGTGCTCGACGTCTA
TCTGCTGTGCCTGCAGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCAGCGGGCCGCTCGACGCG
ATCCGGCAGCGCGCGCTCGACGCGCTGTCGGCGCACGCGCCGCCGTGCGCCGCGCACGCGCTGCCGTTTC
CCGCCGCGTATCCGCACGCCGAGACCCAGCCCGGCGCGCACGCCATCGCGGCGAAGGCGCGCGCGCGCCG
CCGCATCGCGCTCGCCGGACGGAACTTCGGGCTGCCGCTCGCGATCCTGCTGTCGCTTTATCTGATCTAT
CACGCCGTCATCGTGCGGATGGTCGACTCGGTATTCCCGAGGCTGCAATGA