SecReT6
Protein ID: 83716780
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0263
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]322405..323688 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ2T8N4
KEGG IDbte:BTH_II0263
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-128, Aligned region: 75..381
Protein Sequence: 427 a.a.     [Download]
>gi|83716780|ref|YP_438465.1| unnamed protein product [Burkholderia thailandensis E264]
MTAQPKPNPEPAGADAGSHANSKAGRRAGAASNAEPGAMPNADWDAAADATPNATPSATTQADAARRDAW
WRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDEAPRPRVAI
HGFGLFGPNGPLPSHLTEYAYERAAQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPARARFDR
YVASLIGPCDARSCDAPRGANAIAPHAKYHQAGHLVRHTRNPEGLVQILQRYFGVRARIVEHVPRWVMLD
RAQRCAIRATRPTQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGAHAQQLAQWVREYVGIEFD
WDVQLELARGEVPALALGSRDGLGRTAWLGERLDPGPARDLVLGYDGRARGGAGVARARSTAADQAAAAD
AFDRQPA
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|83716035|ref|NC_007650.1|:322405-323688 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACGGCGCAACCGAAGCCGAATCCGGAGCCCGCCGGCGCGGACGCGGGCTCGCACGCGAACTCGAAAG
CGGGCCGGCGCGCGGGCGCGGCTTCGAATGCGGAGCCGGGCGCGATGCCGAATGCGGATTGGGACGCGGC
CGCGGATGCGACGCCGAACGCAACGCCAAGCGCGACGACGCAGGCCGATGCCGCGCGCCGCGACGCATGG
TGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGTTCCACGCGCTGCGCTGGCTCGACGCGCTGT
CGCCGGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCGCGACGAGCCGGTGCGCTTCGGCCAGGCGCC
GTCGCTCGCGTTCGCGGCGGCGATGCTCGCCGACGTGCGCGACGAGGCCCCGAGGCCGCGCGTGGCGATT
CACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCGAGTATGCGTACGAGCGCG
CGGCGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGACCTGTTTCATCATCGGCTGATCCTGCTGTT
CTATCGCGCATGGGCCGACGCGCAGCCGACCGTCAGTCTCGACCGGCCGGCGCGCGCGCGGTTCGATCGC
TACGTGGCCAGCCTGATCGGGCCGTGCGATGCGCGTTCATGCGATGCGCCGCGCGGTGCTAACGCGATCG
CGCCGCACGCGAAGTATCACCAGGCGGGCCATCTGGTGCGGCACACGCGCAACCCGGAGGGGCTCGTGCA
GATCCTGCAGCGCTATTTCGGCGTGCGGGCGCGCATCGTCGAGCACGTGCCGCGGTGGGTGATGCTCGAT
CGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACACAGCCGCTCGGCGGCGCCGTGCTCGGCCGTG
CGGTGCGCGACGCGCAATCGCGCTTTCGGATCGTGCTCGGCCCGCTGACGCTCGACGAGTACCGGCGGTT
CCTGCCGGGCGGCGCGCACGCGCAGCAGCTCGCGCAATGGGTGCGCGAATACGTCGGCATCGAATTCGAC
TGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTGCCGGCGCTCGCGCTCGGCAGCCGCGACGGACTCG
GCCGCACCGCGTGGCTCGGCGAGCGGCTCGATCCCGGCCCCGCGCGCGACCTCGTGCTCGGCTACGACGG
GCGCGCGCGCGGCGGCGCGGGCGTTGCGCGAGCCCGATCGACCGCGGCCGATCAGGCGGCCGCCGCCGAT
GCGTTTGATCGTCAACCTGCCTGA