SecReT6
Protein ID: 83716783
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0869
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1019268..1020794 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ2T6Y3
KEGG IDbte:BTH_II0869
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-185, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|83716783|ref|YP_439066.1| unnamed protein product [Burkholderia thailandensis E264]
MNRDTERTTMEGEHLYSPKNDDAPPAPAPDSPASLLDELIEAARVKRDEEAYPITRHGIEAFVAHLARPK
RPIETVSQATIDDMIAEIDRKLCRQVDAILHHPDFQQLESTWRSLKFLVERTDFRENIKIQFLDVGKAAL
LDDFDDSPDITKSGLYQKVYAAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQFAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYDER
VDGGDADFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVADLPLYAYEAMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKHSDNAAFFSANSTQKPKFFGISKEGKDAELNYRLGTQLPYIFVVNRLAHYIKV
IQRENIGTWKERGDLEQELNQWIRQYVADMDNPTEGVRSRRPLRQAEIFVSDVEGEPGWYRVDMKVRPHF
KYMGASFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1020794-1019268 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAACCGCGACACGGAACGGACGACCATGGAAGGCGAACACCTGTACTCCCCGAAAAACGACGACGCGC
CGCCCGCGCCGGCGCCCGATTCACCCGCATCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAGGAAGCGTATCCGATCACGCGCCACGGCATCGAGGCATTCGTCGCGCATCTGGCGCGGCCGAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGGTCGACGCGATCCTCCACCACCCGGATTTCCAGCAGCTCGAATCGACGTGGCGCTCGCTGAAGTT
CCTCGTCGAGCGCACGGATTTCCGCGAGAACATCAAGATCCAGTTTCTCGACGTCGGCAAGGCGGCGCTC
CTCGACGATTTCGACGATTCGCCCGACATCACGAAATCCGGCCTGTACCAGAAGGTCTATGCGGCCGAGT
ACGGCCAGTTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTATACGTTCGGGCCCGGCGCGCAGGA
TGTGAAGCTGCTGCAATACGTCGCGAGCACGTCGGCGATGGCGCACACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTGGCTTCGCTGTTCGAGG
GGCCGCAGTTCGCGAAGTGGAACGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCCTGCTGCGGCTGCCGTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAATTACGACGAGCGC
GTCGACGGCGGCGACGCGGATTTTCTCTGGGGCAACGCCGCGTTCGCGTTCGCGACGCGGCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGCCCGAAGGGCGGCGGCACGGTCGCCGATCTGCC
GCTCTATGCGTACGAGGCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAATTCGAGCTCGCCGAGCAGGGGTTCATCGCGCTCACGATGCGCAAGCACAGCGACAACGCCGCGT
TCTTCTCCGCCAATTCGACGCAAAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGATGCCGAACT
GAATTACCGGCTCGGCACCCAGCTGCCGTACATCTTCGTCGTCAACCGGCTCGCGCATTACATCAAGGTG
ATCCAGCGCGAGAACATCGGCACGTGGAAGGAGCGCGGCGATCTCGAGCAGGAACTCAACCAGTGGATCC
GCCAGTACGTCGCGGACATGGACAACCCGACCGAGGGCGTGCGCAGCCGCCGGCCGCTGCGCCAGGCGGA
GATCTTCGTGTCGGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCGACATGAAGGTTCGGCCGCATTTC
AAGTACATGGGCGCGTCGTTCACGCTGTCGCTCGTCGGCAAGCTCGAGAAGCGCTGA