SecReT6
Protein ID: 83716825
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0135
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]161157..162206 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2T912
KEGG IDbte:BTH_II0135
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-99, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|83716825|ref|YP_438337.1| unnamed protein product [Burkholderia thailandensis E264]
MTAHPPATPPIDARSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDARMPLPGTACLPREEPFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRADRETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPISVDEYVFHWIRIAEPERCLLGARAASTVMGEGALLGDMVPDCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFIGHEYDWEIKLLVKPRAAPPARADTAHRLGYSTWLGESRDDKPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c162206-161157 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACGGCTCATCCGCCCGCCACCCCGCCCATCGACGCCCGCTCGCCGCTGCATCCGGACGCACTGCGCG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCCGGCTTCCTGAGCTTGTTGCGCGCAATCGCCGCACGCGA
TGCGCGCATGCCTCTGCCGGGCACCGCGTGTCTTCCGAGGGAAGAGCCGTTTCGCATCGGACAACGTCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGTCTCGGCCTATGGGGGCCGCAAGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTATAACCGCGC
GGAGAGCTATCAGGATCACGCGATCGCGCATTTCTCCAATCTCTTTCATCACCGCGCGCTCGCGTTGTTC
TATCGCGCGTGGGCGTCGTCACAAGCAACCGTATCGCTCGACCGCGCAGACCGCGAAACGTTCTCGTTCT
ACATCGGCAGCCTGATGGGCACCGATCCAGAGGAAGCCGCGCGCACGCACCCGCCCACACACGCGCGATA
CGCCGCGTGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCTACGCTGTCTCATTAC
TTCGGCGTGCCGATCTCCGTCGACGAGTACGTCTTCCACTGGATTCGGATTGCGGAGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCGTCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTCCCGATTG
TCAGCACAAGTTCCGGCTGGTCATCGGTCCGCTCGATCTCGACCAGTATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCCACGCTGGTCGATTGGGTGCGCGCTTTCATCGGCCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCGCGCGCCGCACCGCCCGCCCGCGCGGACACCGCGCACCGTCTCGGCTATTCGACCTG
GCTCGGGGAATCGAGGGACGACAAGCCGGTCGTCGGCATGGTGTTCGAGCCTGAAAAATACTGTTCCTGA