SecReT6
Protein ID: 83716919
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0857
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1002249..1003643 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ2T6Z5
KEGG IDbte:BTH_II0857
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.60E-96, Aligned region: 16..462
Protein Sequence: 464 a.a.     [Download]
>gi|83716919|ref|YP_439054.1| unnamed protein product [Burkholderia thailandensis E264]
MDNVYWHQGMLLQPQHFQLAELHQQFRIEPWLASAPPHFWGVGALSIAQAAIDRRVVEIRSAQLLFSERS
YVEYPGNAVVAARAFDPAWLDDGRALVAHVALKRLARGANNVTVAASPDALPDAPTRYATLPCADEIGDL
YSDHPGAPVRTLKHVLKIVFGHELDALAGHETIPIARIVRDGERLRLDDDFAPPCYAVSGSRALLDRVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDRLHPWTVYGVLRQLVG
ELSAFSERFDMLGETPDARGGLPPYDHLDLGGCFSRAHALIGHLLDEISVGPDCVATFEPDGERQPAQRS
AQLPPDVFADRHLIYLAIRSAHDPDTLAQRFLLGGRIAATDEMPQLAALALPGVELTRLPGAPPRLPRRG
DARYFRIEQTGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHA
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1003643-1002249 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTTCGCATCGAGCCGTGGCTCGCATCCGCCCCCCCGCATTTCTGGGGCGTGGGCGCGCTGTCGAT
CGCGCAGGCCGCGATCGATCGGCGCGTGGTCGAGATACGCTCGGCGCAGTTGCTCTTTTCCGAGCGAAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGACGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAAGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTTGCGGCCTC
GCCCGACGCGCTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTGCGCCGACGAGATCGGCGACCTC
TACTCCGACCATCCGGGCGCGCCTGTGCGCACGCTCAAGCACGTGCTGAAGATCGTGTTCGGGCACGAGC
TCGACGCGCTCGCCGGGCACGAGACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAACGTCTGCGGCT
CGACGACGATTTCGCGCCGCCGTGCTACGCGGTCTCGGGCTCGCGCGCGTTGCTCGACCGGGTTCGCTGC
ATTCGCGACGAGCTTGCGGGCCGCGCGCGGCAGCTGCAGCAGTACAAGAATCCGCGCGAGATGCAGCGCG
CCGAGTTCGACGCCAGCTACGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACCGGCTGCATCCGTGGACGGTCTACGGCGTGCTGCGGCAACTCGTCGGC
GAGCTGAGCGCGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTATGACCACCTCGATCTCGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGATGA
AATCTCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCGAGCGGCAGCCCGCGCAGCGATCC
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCTGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCCTGCTCGGCGGCCGGATCGCCGCGACCGACGAGATGCCGCAGCTCGC
CGCGCTCGCGCTGCCGGGCGTCGAGCTGACCCGCCTGCCCGGCGCGCCGCCGCGGCTGCCGCGCCGGGGC
GATGCACGGTATTTCCGGATCGAGCAGACCGGCCGCCCGTGGGACGCGATCCGGCGCGACGGCCGCGTCT
CGCTGCGCTGGGCCGACGCGCCGGACGATCTGCACGCGGAACTCGTCGCAGTGAGGCACGCATGA