SecReT6
Protein ID: 83716922
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0251
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]305598..306116 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ2T8P6
KEGG IDbte:BTH_II0251
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.90E-38, Aligned region: 14..159
Protein Sequence: 172 a.a.     [Download]
>gi|83716922|ref|YP_438453.1| unnamed protein product [Burkholderia thailandensis E264]
MRLRFSGSVALGGALLLAGCGATERSVAVPYSIALDVAPDVNPDINRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPSEMKLQVAVKNGGIGLGGDSRVRR
 
Nucleotide Sequence: 519 bp     [Download]
>gi|83716035|ref|NC_007650.1|:305598-306116 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCGACTGCGATTCAGTGGTTCCGTCGCGCTGGGAGGCGCGCTGCTGCTCGCCGGGTGCGGTGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCGCGCTCGACGTCGCGCCCGACGTCAATCCGGACATCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGTTGAAGACGGCGTCCGCGTTCGAGAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GGCCGGGCGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATACCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGAGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGTCGATGA