SecReT6
Protein ID: 83717013
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0259
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]317896..319404 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ2T8N8
KEGG IDbte:BTH_II0259
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|83717013|ref|YP_438461.1| unnamed protein product [Burkholderia thailandensis E264]
MNEHAQTRADTRAAAQPAVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTAGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFYFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTDAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVEGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAASE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|83716035|ref|NC_007650.1|:317896-319404 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAATGAACACGCTCAAACCCGGGCCGACACGCGCGCGGCCGCGCAGCCCGCCGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAGAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGCAGGCATGACGACCGACGCGTACGGCAGCGTGAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCACCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGGCTGCATTACCTCGTCACGAACACCGAGACCGACGAGTTGCTGAA
GATCAAGGCGCTGCCCGCGTCGCGCAACGAGCTCGCGCGCACGCTCAAGCGCTACAAGGGCGTTGCATGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTTTACTTCAACCACAGCCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCCGCCGCGCACGCACCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAACTGGCCAATCCGCGCGACCTCACGAAGATCTTCCAGAACACCGAATACGCGGCGTGGCGCAGCCTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCCCGGCTGCCGTATGGCGC
GCGCACGAACCCCGTCGACGAATTCGACTTCGAGGAAGACACCGACGCCGCGAGCCACGACCGCTATACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTCGAGGGGCTGCCGTGCCACACGTTCCCGACCGACGACGG
CGGCGTCGACCAGAAGTGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGATTCATGCCGTTCGTTCATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCCGGCCGCCTGCCGTACCTGTT
CGCATGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTTGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAACTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGAGCGAATGA