SecReT6
Protein ID: 83717048
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0260
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]319462..319953 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ2T8N7
KEGG IDbte:BTH_II0260
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-33, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|83717048|ref|YP_438462.1| unnamed protein product [Burkholderia thailandensis E264]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCANGKHLSSVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|83716035|ref|NC_007650.1|:319462-319953 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGGCGTGGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCGTGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCATACATGGACAAGGGCGCGACGGCGATCATC
AAGAACTGCGCGAACGGCAAGCATTTGTCGTCCGTCGAGATCTCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTCGATCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGCTTCCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAGGTGTCGGTCGGCTGGAACATCAAGGAAAACACCGAGATGT
GA