SecReT6
Protein ID: 83717049
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1898
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2304351..2304782 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2T407
KEGG IDbte:BTH_II1898
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.10E-12, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|83717049|ref|YP_440092.1| unnamed protein product [Burkholderia thailandensis E264]
MSDLQLYNKLSRRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPVATTVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDH
 
Nucleotide Sequence: 432 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2304782-2304351 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAGACGGATTCGTCGCCATTCGCTTCAAGAGGTCGTGG
CCGATCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGTTGAACTTCGGCTGTCCGCCGATGCAGATGGCCGGCGCGACGAAGATCAATCCG
GTTCACGCGGCCGCGCACATCTGCGAGGTGATTCGTCGCTTCGAGCCGCGCGTGGATCCCGTTGCCACGA
CGGTCAAACCTCGGACCGAGAGCCGCAAGCGCCTCGCGCAGACGATCTATTTCGATGTATCGATGAAGGC
GCGCGAAGACGGAGCCGAGCTCAGGGCGAGCCTCGCGCTCGATTACCTGAGCGGCTATTTCAGCCTGGCG
GACGACCATTGA