SecReT6
Protein ID: 83717067
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1894
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2296361..2298652 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ2T411
KEGG IDbte:BTH_II1894
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-70, Aligned region: 23..328
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 366..459
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 631..650
Protein Sequence: 763 a.a.     [Download]
>gi|83717067|ref|YP_440088.1| unnamed protein product [Burkholderia thailandensis E264]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGGGDIRTFNTH
VFGGHDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNETLEYLPDGEESRAIQGREGV
QRLQRTRRIKASNVALRDFDYHAPSNKLDSDAQLVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQADSHMLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPYRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLITYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTATSVVGISVSFTGISVSYTGLSVSFTGVSASF
TGVSTSFTGVSTSFTGVSTSFTGVSTSFIGVSTSFTGVDTGFKGVSTAMIGVSTSVVGSSNSVTGVSNSM
TGISSSWTDVSMSTTGQSQSMTGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMST
TGSSTSITGSSVSTTGSSVSTTGSSVSTTGSSVSTTGFSFSYTGASYSDVGIDLKKVGMQVKS
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2298652-2296361 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGTAGTCCCCTGCTGGACCCGGATGCTGTGGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAACCGTCGTATCAGCTCGACTTGCTGAGTCACGACCCGGATCTGGACTTCGACGC
GCTGCTCGGCTCGACACTGTCGGCCGACATCGATCTGGGCGGCGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCCACGACACGGGGCAGATGAGCGGGCAGTACACGTACACGCTGGAGCTGCGGAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAACTGGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGATTGCTGGAGGACGAAGGGATCTATTTCT
GGGTCGAGCACGAGCCGGATCGGCATGTCGTGGTGATTTCGGACACGCAGCGCTTCGAGGATCTGCCGCT
GCCGAACGAAACGCTCGAGTATTTGCCGGACGGCGAGGAATCGCGGGCGATCCAGGGGCGCGAAGGCGTG
CAGCGGCTGCAGCGCACGCGCCGGATCAAGGCAAGCAACGTCGCGCTGCGCGACTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCACAGCTGGTGTCGCCGCCGAATCTCGAAGGGATTCCGCTCGAGTA
CTACGACTATGCGGCCGGCTACCGCGAGCCGGAGCAAGGGGAGCGTCTCGCGCGGCTGCGGCTCGAAGCG
ATCCAGGCGGATTCGCACATGCTCGTCGGCGAGGCGAACGCGCGCGCGCTGGCGACGGGCCGGGCGTTCA
CGCTGATCGGGCATCCGGCGCTGGGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
TCAGGACGGGCCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGAT
CAGCCGTATCGGCCGCTCTTGACGACGCCGCGCCCCGAGGTGCCGGGCATCCAGAGCGCGACGGTGGTGG
GGCCGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGCATCCGCGTGCACTTCCACTGGGACCGCTA
CAAGACGACCGAAGCGGACGCCTCGTGCTGGATTCGCGTGTCGCAGGCGTGGGCCGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTGATCACGTACGTCGACGGCGATCTCGACCGTCCGC
TCGTGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTACGATTTGCCGAAAGACATCCGCTACAC
GGGTCTCGTTTCACGTTCGATCAAGCGCGCCGGCGGCTACCAGAACGCAAGCCAGATCACGTTCGACGAT
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CCACGTCGATCGCGCAGGACTTGAATCTGTCGGTGAAGGGCACGGCGACGTCGGTCGTCGGGATCTCGGT
CAGCTTCACGGGCATCTCGGTGTCGTACACGGGGCTGTCGGTGAGCTTCACGGGCGTATCGGCGAGTTTC
ACCGGCGTGAGCACATCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCG
TGAGCACGAGCTTCATCGGCGTGTCGACGTCGTTTACCGGTGTCGATACAGGCTTCAAGGGCGTGTCGAC
GGCGATGATCGGTGTCTCGACCAGCGTCGTGGGTTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATG
ACGGGCATCTCGTCGTCGTGGACCGACGTCAGCATGTCGACGACCGGGCAGTCGCAGAGCATGACCGGCG
TATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACGTCGAC
GAGCATCACGGGCACGTCGATGTCGAACACGGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACG
ACGGGCAGCTCGACGAGCATCACCGGCTCCAGCGTGTCGACGACCGGCAGCTCGGTGAGCACGACGGGTT
CGAGCGTATCGACGACGGGCAGCAGCGTGTCGACGACGGGATTCAGCTTCTCGTACACCGGGGCGAGCTA
CTCGGACGTGGGCATCGACCTGAAGAAGGTCGGCATGCAAGTGAAGAGCTGA