SecReT6
Protein ID: 83717090
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0863
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1009425..1012463 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ2T6Y9
KEGG IDbte:BTH_II0863
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-65, Aligned region: 58..361
Phage_base_V [PF04717], Evalue: 1.70E-16, Aligned region: 408..501
Protein Sequence: 1012 a.a.     [Download]
>gi|83717090|ref|YP_439060.1| unnamed protein product [Burkholderia thailandensis E264]
MSSSHRHYADTALADVAALTDAASRADAAPLANARRFTFASTAYDAATFDVVDIDGRDAISQPYRFEITL
VSRSVRIDFAKMLSCEATLAILPPFGEAGTTRYAGVLAEFEQKERFRDFTVYRAALVPRLWRLSLYKASD
VYLNEQTIPDIVKRVLRAASFGKRNFRMRHRGVYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRR
EKLEIVDDRRDQPGPADDLALRYLPATCLDAGIESDRVQAFACRATPLPREVVLRDFNHRKAELSLEVRE
HVAHDGVGERVSSDEHFHTKDEGRRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYRKDFDGRY
LVTAVTHRGSQAHLLFPDLDAPFGATPGEPVYRAEFEAIAANLQYRPPRTTPKPRAAGVVSAIVDGEGSG
KRAELDEHGQYKVRFPFAHTAHPTNKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVG
AVPNSSHRSVVTRSNPDAHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFS
LGNAYSFSGGLKCSVSMGGNTDIYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHK
QSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANAGAAATAAGLIKGGGALADLPWAGFGVSA
AQFAGATGFSTALMATSRTLLSKIAKLQEALPLVADLSLDKQGIALAAKNLTHATRMSLTVDGVSWSTHA
KGPGAAGAAMSVGKGRWGVEAAEHAHVHANDTLLFAVPADPTSKFDLKELIGLRRDLDECVKGIADLEAD
ISENEVLSTDQNTFGVGALVPTPPSPANAVAAVAIKAKEAKLVELNAKRKLVATKIDNLQQKLAKHAKNL
SAARMSASDAEVGFKGNRLVATAEGVTLAHAQGKAKLDVREAKIGVEAGKSSLELDESKLAAGCGGASLK
LGSDGAIDVRATNVKLNGSASLKLDGQLIQLG
 
Nucleotide Sequence: 3039 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1012463-1009425 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCTTCGTCCCATCGACACTACGCCGACACGGCGCTCGCGGATGTCGCGGCGCTCACGGATGCCGCGT
CGCGCGCCGACGCCGCGCCGCTCGCGAACGCGCGACGCTTCACGTTCGCGAGCACCGCGTACGACGCTGC
CACGTTCGACGTCGTCGACATCGACGGCCGCGACGCGATCTCGCAGCCGTACCGGTTCGAGATCACGCTC
GTGAGCAGGAGTGTGCGGATCGACTTCGCGAAGATGCTGAGTTGCGAGGCGACGCTCGCGATCCTGCCGC
CGTTCGGTGAGGCCGGCACGACCCGCTATGCCGGCGTGCTCGCCGAATTCGAGCAGAAGGAACGCTTTCG
CGACTTCACCGTCTATCGCGCGGCGCTCGTGCCGCGCCTCTGGCGCCTCTCGCTGTACAAGGCGTCGGAC
GTCTACCTGAACGAGCAGACGATTCCCGATATCGTCAAGCGCGTGCTGCGCGCCGCGTCGTTCGGCAAGC
GCAATTTCCGCATGCGGCACCGCGGCGTCTACCGCAAGCGCAGCTTCGTCTGCCAGTACGACGAGAGCCA
TCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGGCCTCTACTACTACTTCGAGCATGACGGCCGACGC
GAAAAGCTCGAGATCGTTGACGACCGCCGCGACCAGCCCGGCCCCGCCGACGATCTCGCGCTGCGCTACC
TACCCGCCACCTGTCTCGACGCGGGCATCGAATCGGACCGCGTGCAGGCGTTCGCATGCCGCGCGACGCC
GCTGCCGCGCGAGGTCGTGCTGCGCGATTTCAACCACCGCAAGGCGGAGCTGTCGCTCGAAGTCCGCGAG
CACGTGGCGCACGACGGCGTCGGCGAGCGGGTATCGAGCGACGAGCATTTCCACACGAAGGACGAAGGGC
GGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTTTGCGAAGGCCGCCGTTTCGCCGGCGAATCGACCGC
GGCCGGGCTGCGCGCGGGCCGCTTCTTCGCGCTCTCGGGCCACTACCGCAAGGACTTCGACGGCCGCTAT
CTGGTGACGGCGGTCACGCATCGCGGCTCGCAGGCGCACCTGCTGTTTCCCGATCTCGACGCGCCGTTCG
GCGCGACGCCGGGCGAGCCCGTCTACCGCGCCGAGTTCGAGGCGATCGCCGCCAACCTCCAGTACCGGCC
GCCGCGCACGACGCCGAAGCCGCGCGCGGCGGGCGTCGTCAGCGCGATCGTCGACGGCGAGGGCAGCGGC
AAGCGCGCCGAACTCGACGAACACGGCCAGTACAAAGTGCGCTTTCCGTTCGCGCACACCGCGCATCCGA
CGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGCCCTATGCGGGCGACGACCGCGGCATGCATCTGCC
GCTTCTGAAGCGCACCGAAGTGAAGATCGCATTCGACGGCGGCGATCCGGACCGCCCCGTGATCGTCGGC
GCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACGCGCAGCAACCCCGACGCGCACCGGATCCTCACCG
AGCACAACCAGCTCTACATGAAGGACGGCAGCGGCGCGGCGACGTGGCTGCACGCGCCGAACAACCACAT
CGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGCGCTCCTCACGTCCGGCAACAAGTTCGATTTCTCG
CTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAGTGCTCGGTGTCGATGGGCGGCAACACCGACATCT
ACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGAACTTCCTGACGACGCTGCAGGGCAACCTGCGCTG
GATGCTGCCCGGCAGCCGAAGCTTCGAGATCAACGACAGCGCGTCCACGCTGCTGCAGACGCTGCACAAG
CAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGGCAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCG
ACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCGTGTCGGGCCTCGCGAACGCCGGAGCCGCGGCCAC
CGCTGCGGGGCTCATCAAGGGCGGCGGCGCGCTCGCCGATCTGCCGTGGGCGGGCTTCGGCGTGTCCGCC
GCGCAGTTCGCCGGCGCGACCGGCTTCAGCACGGCGCTGATGGCGACCTCGCGCACGCTGCTCTCGAAAA
TCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCGATCTATCGCTCGACAAGCAAGGCATCGCGCTCGC
GGCGAAGAACCTCACGCACGCGACGCGGATGTCGCTCACCGTCGACGGCGTCTCGTGGTCGACGCACGCG
AAGGGGCCGGGCGCGGCAGGCGCCGCGATGAGCGTCGGCAAGGGCCGCTGGGGCGTCGAAGCGGCGGAGC
ACGCGCATGTCCACGCGAATGACACGCTGCTGTTCGCCGTGCCGGCCGACCCAACGAGCAAGTTCGACCT
CAAGGAGCTGATCGGGCTGCGCCGCGATCTCGACGAATGCGTGAAGGGTATCGCCGATCTCGAAGCCGAC
ATTTCGGAAAACGAAGTGCTTTCGACCGATCAGAACACGTTCGGCGTCGGCGCGCTCGTGCCCACGCCGC
CGTCGCCCGCCAATGCGGTCGCGGCGGTCGCGATCAAGGCGAAGGAAGCGAAGCTCGTCGAGCTGAACGC
CAAACGCAAGCTCGTCGCGACGAAGATCGACAACCTCCAGCAGAAGCTCGCGAAGCACGCGAAGAACCTG
AGCGCCGCGCGGATGAGCGCGTCGGACGCGGAAGTCGGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCG
AAGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGAAGCTCGACGTGCGCGAGGCGAAGATCGGCGTCGA
GGCAGGCAAATCGAGCCTCGAGCTCGACGAGAGCAAGCTCGCGGCCGGCTGCGGCGGCGCCTCGCTGAAG
CTGGGCAGCGACGGCGCGATCGACGTGCGCGCGACTAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGC
TCGACGGACAGTTGATCCAGCTAGGCTGA