SecReT6
Protein ID: 83717117
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0865
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1015352..1016407 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2T6Y7
KEGG IDbte:BTH_II0865
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-78, Aligned region: 19..322
Protein Sequence: 351 a.a.     [Download]
>gi|83717117|ref|YP_439062.1| unnamed protein product [Burkholderia thailandensis E264]
MAAADGGAMPALEPVLLGEAKHFAYFQAIRLLRRIVRERREHHAGAASAPAAPMPIHTRPNLALSFPDTD
VERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFKGRHAARGFLDVLHRALYPLLFDAWLKHR
LSLRIVEERDAHALRPLYALAGVDARIARDAGLPEHALLRHVGLLSQRPRSASGLRALLADAFAPAAVDI
EPCVPQWLPIPDDQRTRVGARAHRLGVDARVGARMRDDGARLRIVLRDVPGPLFRALMPGGDAFRRLRFL
VRLYLTQPFTVDVAIRVRARDALPARCGGGAWSRVGLDAWLGGPPAERAAAPQFRLPTSLFDQARPHHAA
G
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1016407-1015352 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCCGCCGCGGATGGGGGCGCAATGCCTGCTCTAGAACCGGTGCTGCTCGGCGAGGCCAAGCACTTCG
CGTATTTTCAGGCGATCAGGCTGCTGCGGCGCATTGTCCGCGAACGGCGCGAGCATCACGCAGGCGCGGC
GAGCGCGCCCGCCGCGCCGATGCCGATCCACACGCGGCCGAATCTCGCGCTGTCGTTCCCGGACACCGAC
GTCGAGCGCATCGATAAGGCGGACGACGGCGGCTACCGCGTCGTCGCGAACTTCTTCGGGCTGTACGGCG
TGTCGTCGCCGCTGCCGACGTTCTATACCGAAGACCTGATCGACGAAGCGTTCAAAGGCCGTCACGCGGC
GCGCGGCTTTCTCGACGTGCTGCATCGCGCGCTCTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGG
CTGTCGCTGCGCATCGTCGAGGAGCGCGACGCGCACGCGCTGCGCCCGCTCTACGCGCTCGCGGGCGTCG
ATGCGCGCATCGCGCGCGACGCGGGCCTGCCCGAGCACGCGCTGCTGCGCCATGTCGGGCTGCTGAGCCA
GCGGCCGCGCTCGGCGTCCGGATTGCGCGCGCTGCTCGCCGACGCGTTCGCGCCCGCGGCGGTCGACATC
GAGCCGTGCGTGCCGCAGTGGCTGCCGATTCCCGACGATCAGCGCACCCGCGTCGGCGCGCGCGCGCATC
GGCTCGGCGTCGACGCGCGCGTCGGCGCACGCATGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTGCG
CGACGTGCCCGGCCCGCTGTTTCGCGCGCTGATGCCGGGCGGCGACGCGTTCCGACGGCTGCGGTTTCTC
GTGCGCCTCTATCTGACGCAGCCGTTCACGGTCGACGTCGCCATCCGCGTGCGCGCGCGCGACGCGCTCC
CCGCGCGCTGCGGCGGCGGCGCGTGGTCTCGCGTCGGGCTCGACGCGTGGCTGGGCGGGCCGCCCGCCGA
ACGCGCGGCAGCGCCCCAATTCCGTCTTCCGACCTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCT
GGTTGA