SecReT6
Protein ID: 83717202
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1902
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2307625..2308569 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ2T403
KEGG IDbte:BTH_II1902
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-19, Aligned region: 46..104
Protein Sequence: 314 a.a.     [Download]
>gi|83717202|ref|YP_440096.1| unnamed protein product [Burkholderia thailandensis E264]
MNDDALPVHSTDLLDFDEDFIKIDAAICEYDSVGHAPQRKGESAFQWASVETACLALLKKAKDVRVAIWY
LRACIARRGLSGLADGVRLLAELMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYCVRANTLVHDIKDSLSRIRESVAVVEQELNLSRSLDLLSVAASRLARTDA
GRAESESVAGEKPAHAEAGFSPAPDPQQPAAGPGGALRSRQEVGVALERIVEYFRLHEPSHPAPIFLSRI
QRMLGAGFEEVMAELYPEAASLVAQLNRPQSSIK
 
Nucleotide Sequence: 945 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2308569-2307625 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAACGACGATGCACTGCCAGTCCATTCGACGGACTTGCTGGATTTCGACGAGGATTTTATCAAAATCG
ACGCAGCTATCTGCGAATACGATTCCGTCGGTCACGCGCCACAACGCAAAGGAGAGAGCGCGTTCCAGTG
GGCCTCCGTTGAAACGGCATGTCTTGCTCTATTGAAAAAGGCAAAGGACGTTCGGGTCGCCATTTGGTAT
CTGCGCGCCTGCATCGCGCGGCGCGGATTAAGTGGGTTGGCCGATGGCGTTCGGTTGCTGGCCGAGCTGA
TGAGCGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAGTCGCCCGGCGAAACACTGCTGAT
TCATCTCGGCTGGCTTGCGGGGCCGCAGTTTCTGCATCAGCTCGGCAGTTCGCGGTTCGAAGACCGCGAC
GCGACGCTCAACGATCTGATCGGCGGGCGTGCCGCCGCGATCGTGGAGGATCGCGACTACTGCGTTAGAG
CGAATACTCTTGTACATGACATTAAGGATTCCTTATCGCGAATCAGGGAATCAGTCGCAGTGGTAGAGCA
AGAGCTCAACCTGTCGCGCTCGCTCGACCTGTTGAGCGTTGCGGCGTCGCGGCTCGCGCGGACGGACGCG
GGGCGTGCGGAAAGCGAAAGCGTCGCCGGCGAGAAGCCGGCCCATGCCGAGGCCGGCTTCTCGCCGGCAC
CCGACCCGCAGCAGCCGGCCGCGGGGCCGGGCGGCGCGCTGAGATCGAGGCAGGAAGTCGGGGTGGCGCT
CGAGCGGATCGTCGAGTACTTCCGCTTGCATGAGCCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATT
CAACGAATGCTGGGTGCGGGTTTCGAGGAGGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGG
CCCAGCTGAACCGGCCGCAGAGCTCCATCAAGTAA