SecReT6
Protein ID: 83717233
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0858
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1003676..1004482 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ2T6Z4
KEGG IDbte:BTH_II0858
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-24, Aligned region: 49..210
Protein Sequence: 268 a.a.     [Download]
>gi|83717233|ref|YP_439055.1| unnamed protein product [Burkholderia thailandensis E264]
MSDRRIFMPAAAQARRPTQPAQACRSSRQLRPRRACAARACAATLAALAALAGCAAGVTEEQARADVRWD
YAPDALRIDIDASPRLNEYLNAPHTLLLAVFQSADARTFRQLADDPDRLRMTLAAGGPATDFIQTTRYVV
EPGARVALSIDRAQQARYVGIVAGYYDADSPRAARLFDVPLRIDKRGWFSSTYRAAPRTLGLKLRLGAQS
ITDAREAPLNLPPPGARAWTTLDGGAKTLTLPAGDANGSENGGGGDENDASAHAPRKR
 
Nucleotide Sequence: 807 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1004482-1003676 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAGCGATCGACGGATTTTCATGCCGGCGGCAGCGCAAGCGCGCCGGCCGACGCAACCGGCGCAAGCTT
GCCGATCATCACGGCAGTTGCGGCCACGCCGCGCATGCGCGGCGCGCGCGTGCGCGGCCACGCTCGCCGC
GCTGGCCGCGCTGGCCGGCTGCGCGGCCGGCGTCACCGAGGAGCAGGCGCGCGCCGACGTGCGATGGGAC
TACGCGCCCGACGCGCTGCGCATCGACATCGACGCGTCGCCACGGCTCAACGAATACCTGAACGCGCCGC
ACACGTTGCTGCTCGCGGTGTTCCAAAGCGCGGACGCGCGGACGTTCCGCCAGCTCGCCGACGATCCGGA
CCGGCTGCGCATGACGCTCGCGGCGGGCGGCCCCGCGACGGACTTCATCCAGACGACGCGCTACGTGGTC
GAGCCGGGCGCGCGCGTCGCGCTGTCGATCGATCGTGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCG
GCTACTACGACGCCGACAGCCCGCGCGCCGCGCGCCTCTTCGACGTGCCGCTGCGAATCGACAAGCGCGG
CTGGTTCTCGTCCACCTACCGCGCCGCGCCGCGAACGCTCGGGCTGAAGCTGCGGCTCGGCGCGCAGAGC
ATCACCGACGCGCGCGAAGCCCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCGTGGACGACGCTCGACG
GCGGCGCGAAAACGCTGACGCTGCCGGCCGGCGACGCGAACGGAAGCGAAAACGGCGGCGGCGGCGACGA
AAACGACGCCTCCGCCCACGCGCCGCGCAAGCGATGA