SecReT6
Protein ID: 83717306
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0249
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]303044..304426 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ2T8P8, Q2T8P8
KEGG IDbte:BTH_II0249
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.80E-10, Aligned region: 8..75
FHA [PF00498], Evalue: 4.80E-10, Aligned region: 8..75
Protein Sequence: 460 a.a.     [Download]
>gi|83717306|ref|YP_438451.1| unnamed protein product [Burkholderia thailandensis E264]
MFHPPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVSTIEVNRVPIGYAQAQRLNMGD
IIRIGPYLLRAEPDDAMIERTIEAAAAAPPAASASASHAQTRGAGNKLWGLLHDRFGLGRTQDASGKSGE
RPGAAPSRHHDSPARAAPRELHQLSTDPLDLFAQPQGHLDAQAGVAREGDGRGPPTGTPSDHAPEWTQHV
RVQPAKSAPAAAAHSDAPPAHPGDANDMNDAVETRDAHDVPSRVRASTPATPETLLQAFFEGAGLDAAAE
RHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLKLLPDGSAVLRQMFGLPL
PGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAEPRWHEKRVPVLYKARLWDRY
VATHRDTLFAIEDDFASVFGKAFLCAYDAEVENYRGRCRR
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c304426-303044 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGTTTCACCCGCCGGGCGGCACGATCGGCCGCGACAGCGACAATCACCTCGTGCTGCGCGACGACACGC
GGCAAATCTCGCGCCTTCAGGCGCTGCTGCAAGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAG
CGTGTCGACGATCGAGGTGAACCGCGTGCCGATCGGCTATGCGCAGGCGCAGCGCCTGAACATGGGCGAC
ATCATCCGGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGATGATCGAGCGGACCATCGAAG
CGGCGGCCGCCGCGCCGCCGGCGGCATCGGCATCGGCATCGCACGCGCAGACGCGGGGCGCGGGCAACAA
GCTGTGGGGCCTGCTGCACGATCGCTTCGGGCTCGGCAGGACGCAGGACGCGAGCGGCAAGTCCGGCGAG
CGGCCGGGCGCCGCGCCGTCGCGCCATCACGATTCGCCGGCGCGCGCCGCGCCGCGCGAGCTGCATCAGC
TATCGACCGATCCGCTCGACCTGTTCGCGCAGCCGCAAGGCCATCTCGATGCGCAGGCCGGCGTCGCGCG
AGAAGGCGACGGCCGCGGGCCGCCAACCGGCACGCCATCGGATCACGCGCCCGAATGGACGCAGCACGTC
CGCGTGCAGCCGGCGAAATCCGCGCCGGCCGCCGCCGCGCATTCGGACGCGCCGCCCGCGCATCCGGGCG
ACGCGAACGATATGAATGACGCAGTCGAGACGCGCGACGCGCACGACGTGCCGTCGCGCGTGCGCGCATC
GACGCCGGCGACGCCCGAGACGCTGCTGCAGGCGTTCTTCGAGGGCGCGGGGCTCGACGCCGCGGCCGAG
CGGCACCATTGGTCCGCGGAGCAGTTGTTCGTCGCGGGGCAGTTGCTCGCGCTGTTCGCGAACGGCACGG
TCGAGCTGCTGTCGTCGCGCAGCATCCTGAAGCGCGAAGTGAAAGCCGACATGACGATGCTGCTCGATCG
CGAGAACAATCCGCTGAAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTG
CCGGGCTTCATGACGCCGCAAAGCGCGGTGTCCGACGCGTTCCAGGATCTGCACGCGCATCAGATCGGCA
TGGTGGCCGGCATGCGCGCCGCGCTGATGGACCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCG
CGACGCCGAGCCGCGGTGGCACGAGAAGCGCGTGCCCGTGCTGTACAAGGCGCGCTTGTGGGACCGCTAC
GTGGCCACGCATCGCGACACGCTGTTCGCGATCGAAGACGATTTCGCGTCCGTGTTCGGCAAGGCGTTCC
TCTGCGCCTACGACGCGGAAGTGGAGAACTATCGCGGGCGCTGCCGGCGCTGA