SecReT6
Protein ID: 83717324
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0265
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]326364..328559 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ2T8N2
KEGG IDbte:BTH_II0265
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.30E-85, Aligned region: 20..322
Phage_GPD [PF05954], Evalue: 6.30E-85, Aligned region: 539..634
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 361..453
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 513..536
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 522..544
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 553..576
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 643..661
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 712..724
Protein Sequence: 731 a.a.     [Download]
>gi|83717324|ref|YP_438467.1| unnamed protein product [Burkholderia thailandensis E264]
MFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGIVAR
AALVGRRAQRHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLVTYGFPIENHLTDTYAPRDYCVQ
YNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDSWLP
AQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHER
ALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQVLVQPSSLPYRS
PRATPRPRTNGPQTATVVGPVGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGVQIP
RIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTTEHSNAFRFEDKKGAEQ
LWMHAERNFDAETEQDHTLSVGHDHSHSVGNNETMSVANDRQRSVGQNETVNIGKHRVAQIGGNETHGVA
GNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTNSKSMKTAVVQHHAEEI
GSRTSTIKNAHVLNVGDSQSVNVGASHTMSVRNNVHVGAGDEIALVCGHASITLKKDGTILINGVTVESS
ASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2196 bp     [Download]
>gi|83716035|ref|NC_007650.1|:326364-328559 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCATCGCCTCTACGGCGAGGAAGCGCTCG
GGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGAACTGCTCGG
CAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATCGTCGCGCGC
GCCGCGCTGGTCGGGCGGCGCGCGCAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGTGGCTGTGGC
TCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAGATCGTGCAGGACGTGCT
CGTCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTACTGCGTGCAG
TACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACTACTTCAAGC
ACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCCGGGCTACGA
GCACATTCCGTTCATTGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGCTGGCTGCCC
GCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCGCGGATCTGT
CCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCCCGGCGGCTA
TCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAAGCGGAGCACGAACGC
GCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACTGCCCGCGCG
CCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCGTACGCGACCGA
CAGCGGAAACGAAGCGGTCGTGCACGAATCGCAGGTGCTCGTGCAGCCTTCGAGCCTGCCGTATCGCTCG
CCGCGCGCAACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGGTGGGAGAAG
AAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCAGAGCGACCA
GAACTCATCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTGCAGATCCCG
CGCATCGGCGATGAAGTGGTGGTCGATTTTCTGAATGGCGATCCGGATCAGCCGATCGTGACGGGGCGCG
TGTACAACGGCGAGAAGATGCCGCCTTGGGGGTTGCCCGGCAGCGCGACGCAAAGCGGGCTGCTGTCGCG
CTCGTCGCCGGGCGGCACGACCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGCGCGGAGCAA
CTGTGGATGCACGCGGAACGCAACTTCGACGCGGAAACCGAGCAGGACCACACGCTGTCGGTGGGCCACG
ATCACTCGCATTCGGTCGGCAACAACGAGACGATGAGCGTCGCGAACGACCGGCAGCGGAGCGTCGGGCA
GAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCATGGCGTCGCG
GGCAATCGCACGCGGCAGGTCGGACAGAACGAGGCCGTGACGATCGGCGCGAATCGCGAGGCGACGATCG
GCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATCGGGCAGGGCAAGACGCTGAACGT
CACCCAGCACTACCAGACGAATTCGAAAAGCATGAAGACCGCCGTCGTCCAACATCACGCCGAGGAGATC
GGCTCGCGAACGTCGACGATCAAGAACGCGCACGTGCTCAATGTCGGTGATTCGCAATCGGTGAACGTTG
GCGCAAGCCATACGATGAGTGTGAGGAACAACGTGCATGTCGGCGCTGGCGATGAAATCGCACTCGTTTG
CGGCCACGCGAGCATCACGCTGAAGAAGGACGGCACGATCTTGATCAACGGCGTCACGGTGGAATCGAGC
GCCAGCGGAAGCCATAGCGTGCGCGGCAAGACGGTGACGTCGTCGGCGACGGGCGAGCACACGGTGGAAG
GCACGATACTGAAACTGAACCCCTGA