SecReT6
Protein ID: 83717355
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0140
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]166857..169613 [+]
ProductClpA/B type protease
NoteTssH
UniProt IDQ2T907
KEGG IDbte:BTH_II0140
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.20E-39, Aligned region: 267..347
AAA_2 [PF07724], Evalue: 6.20E-39, Aligned region: 645..810
AAA [PF00004], Evalue: 1.60E-21, Aligned region: 269..400
AAA [PF00004], Evalue: 1.60E-21, Aligned region: 650..734
AAA_5 [PF07728], Evalue: 6.90E-15, Aligned region: 269..347
AAA_5 [PF07728], Evalue: 6.90E-15, Aligned region: 649..767
ClpB_D2-small [PF10431], Evalue: 3.70E-14, Aligned region: 477..494
ClpB_D2-small [PF10431], Evalue: 3.70E-14, Aligned region: 817..889
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 246..290
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 310..347
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 619..692
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 714..733
Sigma54_activat [PF00158], Evalue: 6.90E-09, Aligned region: 265..349
Sigma54_activat [PF00158], Evalue: 6.90E-09, Aligned region: 619..748
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 269..350
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 401..437
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 648..672
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 711..736
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 267..293
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 647..671
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 269..311
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 649..687
AAA_18 [PF13238], Evalue: 1.80E-05, Aligned region: 269..326
AAA_18 [PF13238], Evalue: 1.80E-05, Aligned region: 650..681
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 269..290
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 642..689
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 269..307
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 473..521
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 647..675
AAA_14 [PF13173], Evalue: 3.50E-05, Aligned region: 269..350
AAA_14 [PF13173], Evalue: 3.50E-05, Aligned region: 648..736
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 269..297
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 649..676
AAA_29 [PF13555], Evalue: 5.50E-05, Aligned region: 261..286
AAA_29 [PF13555], Evalue: 5.50E-05, Aligned region: 647..674
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 260..290
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 649..669
DEAD [PF00270], Evalue: 0.0011, Aligned region: 257..282
DEAD [PF00270], Evalue: 0.0011, Aligned region: 335..355
DEAD [PF00270], Evalue: 0.0011, Aligned region: 413..438
DEAD [PF00270], Evalue: 0.0011, Aligned region: 649..856
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 270..291
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 650..671
CbiA [PF01656], Evalue: 0.0036, Aligned region: 272..319
CbiA [PF01656], Evalue: 0.0036, Aligned region: 650..671
NTPase_1 [PF03266], Evalue: 0.0048, Aligned region: 269..291
NTPase_1 [PF03266], Evalue: 0.0048, Aligned region: 321..346
NTPase_1 [PF03266], Evalue: 0.0048, Aligned region: 649..671
RuvB_N [PF05496], Evalue: 0.0064, Aligned region: 267..287
RuvB_N [PF05496], Evalue: 0.0064, Aligned region: 336..349
RuvB_N [PF05496], Evalue: 0.0064, Aligned region: 611..670
RuvB_N [PF05496], Evalue: 0.0064, Aligned region: 718..742
TIP49 [PF06068], Evalue: 0.0069, Aligned region: 269..294
TIP49 [PF06068], Evalue: 0.0069, Aligned region: 648..684
T2SE [PF00437], Evalue: 0.0084, Aligned region: 259..290
T2SE [PF00437], Evalue: 0.0084, Aligned region: 646..718
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 269..281
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 647..667
UPF0079 [PF02367], Evalue: 0.0094, Aligned region: 269..290
UPF0079 [PF02367], Evalue: 0.0094, Aligned region: 647..675
Protein Sequence: 918 a.a.     [Download]
>gi|83717355|ref|YP_438342.1| unnamed protein product [Burkholderia thailandensis E264]
MSCLSRQARLHMTEPDTTRHFPVLHASVAYSRIHDRDMTVSRQALFGKLGHSLFRSIESATAFCKLRGNP
YVELVHWLHQMLQAADGDIQRIARHCDIDIGELDRDMVRALDELPAGASSISDFSHHIETAIERAWVLAT
LDFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRIRVDELDAMLPAWIDGSPEANETPYDNSDFGAAT
PGEASSALQQKGGGSPLEQFCLDLTARARAGQIDPVVGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTA
VVEGLARAIADGDVPPKLADVRLLSLDVGALLAGASMKGEFEARLKGVLEAATKATQPVILFVDEIHTLI
GAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLT
RTFSRHHGVVVLDEAIRAAVKLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDVRRRLEAARV
RLELLDGEQRIGLGDESALAQSRDEIAALEVQEQAIDACWRQQIEAAQALLSAREAAGDDPATAIDALRE
LERALSSLQGDCAFVFPEVNEAIVAEIMSDWTGIPVGRMVTDEVSAVRALPDTLAARVIGQRDALHQICD
RVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPG
YVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGS
ELVSGLCTDEACAPDADGLCAALAPALLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVARMAEN
QAVALSYSDNVVDYVVGRCLVQETGARLLIGFIEQHVLPLLAKCWLDSLSSKTVFTRVDLDVADSGAAPA
QAFVLRAS
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|83716035|ref|NC_007650.1|:166857-169613 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCGTGCCTTTCCAGGCAAGCGCGCTTGCACATGACGGAGCCGGACACGACGCGCCATTTTCCGGTTT
TGCATGCAAGCGTCGCATATTCACGAATTCACGATCGAGACATGACAGTTTCAAGACAGGCACTATTCGG
CAAGCTCGGCCACTCGCTGTTTCGCAGCATCGAGTCGGCGACGGCGTTCTGCAAGCTTCGCGGCAACCCC
TACGTCGAACTGGTGCATTGGCTGCATCAGATGCTTCAGGCCGCTGACGGCGATATCCAGCGGATCGCTC
GTCACTGCGATATCGACATCGGCGAACTGGATCGCGACATGGTGCGCGCGCTCGATGAGTTGCCGGCGGG
CGCGAGCTCGATCAGCGATTTCTCGCACCATATCGAGACGGCGATCGAGCGCGCGTGGGTGCTGGCGACA
CTGGACTTCGGCGATCGTCGGATTCGGGGCGCGTGGCTGTTGGCTGCGTTGCTGAAAACGCCGGAGCTCA
GGCGCGTATTGCTGTCGATTTCGTCCGCGTTCGGCCGGATTCGCGTCGACGAGCTCGACGCGATGTTGCC
GGCGTGGATCGATGGCTCGCCCGAGGCGAACGAGACGCCGTACGACAACAGCGACTTCGGCGCCGCCACA
CCGGGCGAGGCATCGAGCGCGCTGCAGCAGAAGGGGGGCGGTTCGCCGCTGGAGCAGTTCTGCCTCGACC
TCACCGCGCGGGCGCGAGCGGGGCAGATCGATCCGGTGGTCGGTCGCGAGCTGGAAATCCGGACGATGAT
CGACGTCCTGCTGCGCCGCCGCCAGAACAATCCGCTGCTCACGGGCGAGGCGGGTGTGGGCAAGACGGCC
GTCGTCGAAGGGCTCGCGCGTGCGATCGCCGATGGCGATGTGCCGCCGAAGCTTGCCGATGTGCGCCTGC
TGAGCCTCGATGTCGGCGCGCTGCTGGCCGGGGCGAGCATGAAGGGCGAATTCGAGGCGCGCCTGAAAGG
CGTGCTGGAAGCGGCGACGAAAGCGACGCAGCCCGTCATTCTGTTTGTCGACGAGATCCACACGCTGATC
GGCGCGGGCGGCCAGGCGGGCACCGGAGATGCCGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGGCACGC
TTCGAACGATCGGTGCGACGACGTGGGCGGAATACAAGCGGCACATCGAAAAAGATCCGGCGCTCACACG
CCGCTTCCAGGTGTTGCAGGTGCCCGAGCCCGATGAGGCGGCCGCGATCGACATGGTGCGCGGGCTGACG
CGCACCTTCTCGCGTCATCACGGCGTCGTCGTGCTGGACGAGGCGATTCGCGCGGCGGTCAAGCTGTCGC
ATCGCTACATTCCATCCCGTCAGTTGCCGGACAAGGCGATCAGCTTGCTCGATACGGCGTGCGCGCGCGT
CGCGTTGTCGCAACATGCGCCGCCGCGTGAGTTGCAGGACGTCCGTAGAAGATTGGAAGCGGCGAGGGTG
CGGCTCGAACTGCTCGACGGCGAGCAGCGCATTGGCCTCGGCGACGAAAGCGCGCTCGCGCAGTCTCGCG
ACGAAATCGCCGCGCTCGAAGTGCAAGAGCAAGCGATCGATGCGTGCTGGCGGCAGCAGATCGAGGCGGC
GCAGGCGCTGCTCAGCGCGCGCGAAGCGGCGGGCGACGATCCGGCAACGGCGATCGACGCGCTGCGCGAG
CTGGAGCGAGCGCTGTCGAGCTTGCAAGGCGATTGCGCATTCGTCTTCCCCGAGGTCAACGAAGCGATCG
TCGCCGAGATCATGTCCGACTGGACCGGCATTCCGGTGGGCAGGATGGTGACGGACGAAGTGTCCGCCGT
GCGTGCATTGCCGGATACGCTGGCCGCCCGGGTGATCGGTCAACGCGATGCGCTGCATCAGATTTGCGAT
CGGGTGCAAACGGCGCGCGCCGGATTGACGGACCCGAAGAAGCCGCTCGGCGTGTTTCTGCTCGCGGGGC
CGTCGGGCGTCGGCAAGACGGAGACAGCGTTGGCGCTTGCCGAAGCGCTGTACGGCGGCGAGCAGAATCT
CATCACGATCAACATGAGCGAGTATCAGGAGGCGCATACGGTATCGGGGCTGAAGGGCGCGCCGCCGGGT
TACGTCGGATACGGCGAGGGCGGCGTGCTGACCGAGGCTGTGCGCCGGCGTCCGTATTCCGTCGTGCTCC
TCGACGAGATCGAGAAGGCGCATCCCGACGTCCACGAAATGTTCTTCCAGGTATTCGACAAGGGCTACAT
GGAGGACGGCGACGGTCGCTATATCGATTTTCGCAACACGACGATTCTTCTCACCAGCAACGCAGGCTCC
GAACTCGTGTCCGGACTGTGCACGGACGAGGCTTGCGCGCCCGACGCGGATGGCCTTTGCGCCGCGCTCG
CTCCGGCATTGCTCAAGACGTTTCCCGCCGCGTTTCTCGGGCGCGTGACGCTGGTGCCCTATCGTCCGCT
GGCGCAAGAAACGCTATCGCGCATCGTCAGGCTGCATCTCGATCGAGTGGTGGCCCGAATGGCCGAGAAT
CAGGCGGTCGCACTGAGCTATTCGGACAATGTCGTCGATTACGTCGTCGGTCGCTGTCTCGTCCAGGAAA
CGGGCGCGCGCCTGCTGATCGGCTTCATCGAGCAGCATGTGCTGCCGCTGCTCGCGAAGTGCTGGCTGGA
TTCGCTTTCGTCCAAGACCGTGTTCACGCGGGTCGATCTCGACGTTGCCGATTCCGGCGCGGCTCCCGCG
CAAGCGTTTGTCCTGCGCGCTTCTTGA