SecReT6
Protein ID: 83717451
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0870
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1020791..1021285 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ2T6Y2
KEGG IDbte:BTH_II0870
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-52, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|83717451|ref|YP_439067.1| unnamed protein product [Burkholderia thailandensis E264]
MTTNGSVAPKERVNIVYRPATGDAKAEVELPLKVLVLGEFSTADDKPPIEELAPVNVDKDDFNDVMKAQR
LTLALSVPNLLDDQAGEDDRLSVALGFESIADFSPDAIVETVPELKQLVALRDALKALKGPLGNIPGFRK
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1021285-1020791 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACCACGAACGGATCCGTCGCGCCGAAAGAGCGGGTCAACATCGTCTATCGCCCGGCCACGGGCGACG
CGAAAGCGGAAGTCGAGCTGCCGCTGAAGGTGCTCGTGCTCGGCGAATTCTCGACGGCCGACGACAAGCC
GCCGATCGAGGAGCTCGCCCCCGTGAACGTCGACAAGGACGATTTCAACGACGTGATGAAGGCGCAGCGC
CTGACGCTCGCGCTCAGCGTGCCGAACCTGCTCGACGATCAGGCGGGCGAGGACGATCGCCTGAGCGTCG
CGCTCGGATTCGAATCGATCGCCGACTTCTCGCCCGACGCGATCGTCGAGACGGTGCCCGAGCTGAAGCA
GCTCGTCGCGCTGCGCGACGCGCTGAAGGCGCTCAAGGGCCCGCTCGGCAACATCCCGGGCTTTCGCAAG
CGCATCCAGGAAATCGTCGCGGACAAGGGCGCGCGCAAGCAACTGCTCGACGAACTGGGCCTCGACGAAC
AATGA