SecReT6
Protein ID: 83717481
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0867
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1018142..1018618 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2T6Y5
KEGG IDbte:BTH_II0867
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-19, Aligned region: 42..135
Protein Sequence: 158 a.a.     [Download]
>gi|83717481|ref|YP_439064.1| unnamed protein product [Burkholderia thailandensis E264]
MARAEGVSARLPARAPARAPSGERRLLERIADREAGGERSPSADALARSIIDHLRRILNTRQGHVPIDPA
FGVPDFTNLAGGFAQGSAREIEAQIERVIACYEPRLKSPRVTLAERALDAATLHFSLDARLVLDAREVPA
RFLTTVSGNGKIDIRTIS
 
Nucleotide Sequence: 477 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1018618-1018142 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCGCGCGCCGAAGGTGTGAGCGCCCGCCTGCCGGCGCGCGCGCCCGCCCGCGCGCCGTCGGGCGAGC
GCCGGCTGCTCGAGCGGATCGCGGACCGTGAAGCGGGCGGCGAGCGCTCGCCGTCCGCCGACGCGCTCGC
GCGCTCGATCATCGATCATCTTCGCCGCATCCTGAACACGCGGCAAGGCCACGTGCCGATCGATCCGGCC
TTCGGCGTGCCGGACTTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAGATCGAGGCGC
AGATCGAGCGCGTGATCGCGTGCTACGAGCCGCGGCTGAAATCGCCGCGCGTCACGCTCGCCGAGCGGGC
GCTCGACGCGGCGACGCTGCACTTCAGTCTCGACGCGCGGCTCGTGCTCGACGCGCGCGAAGTTCCGGCG
CGCTTCCTGACGACTGTCAGCGGCAACGGAAAGATCGATATCCGAACCATTTCCTGA