SecReT6
Protein ID: 83717522
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0262
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]320537..322408 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ2T8N5
KEGG IDbte:BTH_II0262
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.20E-215, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|83717522|ref|YP_438464.1| unnamed protein product [Burkholderia thailandensis E264]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPVPSMAIMQFTPMMNEGSLAQGYRLPAGTALRARPAASEQTACEFRTAHDLTLWP
LELTAASVTGAPAYLPRSATAARRDVRGALRIRLKACGGASLAKLPIERLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGADALAHQGFDAAQALLPDDGRSFQGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHVALNCTPAVNLFARRGDRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEPRDDAQAREFRPFHASFAGDDGNYGAYYTVRREPRLVSARARANGTRTGYVGSETFVS
LVDSECAPYDESIRYLSADTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAAIRGPSRPRAPIADAQTAW
RLVSHLGLARQTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFTPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|83716035|ref|NC_007650.1|:320537-322408 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGACACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTACCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGCTGCTTGAAGGCTTCAGCTTCCTCACCGCGCGCGTGCAGCTGAAGATGGATGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCCGTTTATCCGGGCTACGTCGCGCCGGTTCCGTCGATGGCGATCATGC
AGTTCACGCCGATGATGAACGAAGGCAGTCTCGCGCAAGGCTACCGGCTGCCGGCCGGCACCGCGCTGCG
CGCGCGGCCGGCCGCGTCCGAGCAGACCGCGTGCGAGTTTCGCACCGCGCACGATTTGACGCTGTGGCCG
CTGGAACTCACGGCCGCGTCGGTGACGGGCGCGCCCGCGTACCTGCCGCGCTCGGCGACGGCCGCGCGGC
GCGACGTGCGCGGCGCGCTGCGCATCCGCCTGAAGGCGTGCGGCGGCGCGAGCCTCGCGAAACTGCCGAT
CGAGCGCCTGATGTTCCATCTCGCCGGACCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTGTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGCGCTCGGCGCGGACG
CGCTCGCCCATCAGGGCTTCGACGCCGCCCAGGCGCTGCTGCCAGACGACGGCCGCAGCTTCCAAGGCTA
TCGCCTGCTGCGCGAGTATTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAGGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGACCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACGTCGCGTTGAACTGCACGCCGGCCGTCAATCTGTTCGCGCGTCGCGG
AGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTATGCGGTGCGGCGGCTCGCGGGCGAGCCGCGCGACGACGCCCAGGCGCGCGAGTTCCGGC
CGTTCCACGCGTCGTTCGCGGGCGACGACGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
GCTCGTATCCGCGCGCGCGCGCGCGAACGGCACGCGCACGGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGACAGCGAGTGCGCGCCGTACGACGAATCGATCCGCTATCTGTCCGCCGACACGCTGTGCACGA
ATCGCGATCTCGTGCTGCTGCTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCGCGATTCGCGGGCCGTCGCGGCCGCGCGCGCCGATCGCCGATGCGCAGACCGCGTGG
CGGCTCGTGAGCCACCTCGGGCTCGCGCGCCAAACGCTGACCGACGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAACTGCTCGGCCTGCATGCGGACCCGGCCGACGCGGCGATGCGCCGGCAGATCGACGGCGT
GCATCGCGTCGCGTTCACGCCGGTGTTTCGCAGGCTGCCCGCAGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGATGTGACCGTCGACGATCATGCGTTTTCCGGCGACAGCCCGTATCTGCTCGGCGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA