SecReT6
Protein ID: 83717553
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0252
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]306113..307519 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ2T8P5
KEGG IDbte:BTH_II0252
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.30E-160, Aligned region: 30..467
Protein Sequence: 468 a.a.     [Download]
>gi|83717553|ref|YP_438454.1| unnamed protein product [Burkholderia thailandensis E264]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDALQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGGEGNGSGNGSGNGN
AGAGFARYVVREHEIADANEVALGPALLQTGRLNVRLMLESELTGDWEALGVARIVERRTDGRLLVDDGY
IPPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVA
AHPETLFRDWLKLACDLSTFTAAGRRPQSLAIYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDAG
NGMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQ
IPYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|83716035|ref|NC_007650.1|:306113-307519 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCGGCGGCGTTGCGCCAGCGTGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCATTGGGAACGCTACGTCGGCATGCGCTGCCT
GCCGTTGCAGGGCTTCTACTGGGGCTACGACGCGCTTCAAATCGACCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGATCTGTCGCATCCGGACGATC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTCTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGGCGAAGGCAACGGAAGCGGCAACGGAAGCGGCAACGGCAAC
GCGGGCGCGGGTTTCGCGCGCTACGTCGTGCGCGAGCACGAAATCGCCGACGCGAACGAGGTCGCGCTCG
GCCCCGCGCTGTTGCAGACCGGTCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTG
GGAGGCGCTCGGCGTCGCGCGGATCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTAC
ATTCCGCCGCGACTCGTCGCGCAGCGCGATCCGGTGCTGCTGCGTCACACGCGCGAGCTGCACGGGCTGC
TCACGCAGCGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTGGC
CGACTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGACGTCGCC
GCGCATCCGGAGACGCTGTTCCGGGATTGGCTGAAGCTCGCGTGCGATCTGAGCACGTTCACTGCGGCGG
GCCGTCGGCCGCAGTCGCTCGCCATCTACCGGCACGACGATCTGCGCGCGAGTTTCGGCGAACTGATGGC
GGAGCTGCGCCGCTCGCTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGATGCGGGC
AACGGGATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGATACCGCGGGCTTCGTGCTCGCGGTGC
GCGCCGACGTGCCGGCCGACAGCCTGCGTGCGCGCTTTCCCGCGCAGGCGAAGCTCGGGCCCGTCGAGCG
GATTCGCGATCTCGTGCAATTGCAGCTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCTCGGCAG
ATTCCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAGCAGCTCGAAC
GCTCCGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCG
CGGGTGA